Align Arginine transport ATP-binding protein ArtP; EC 7.4.2.- (characterized)
to candidate 3607124 Dshi_0546 ABC transporter related (RefSeq)
Query= SwissProt::P0AAF6 (242 letters) >FitnessBrowser__Dino:3607124 Length = 338 Score = 150 bits (380), Expect = 2e-41 Identities = 93/222 (41%), Positives = 127/222 (57%), Gaps = 10/222 (4%) Query: 3 IQLNGINCFYGAHQALFDITLDCPQGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLNIA 62 I+++ IN FYG QALFDI LD GE +V +GPSG GKS+LLR L LE SG + I Sbjct: 4 IKIDKINKFYGTTQALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGRIEIG 63 Query: 63 GNHFDFTKTPSDKAIRDLRRNVGMVFQQYNLWPHLTVQQNLIEAPCRVLGLSKDQALARA 122 G T P+D R++ MVFQ Y L+PH+TV++N+ E +V G D R Sbjct: 64 GRDVT-TVEPAD-------RDLAMVFQSYALYPHMTVRENM-EFGMKVNGFEPDLRKERI 114 Query: 123 EKLLERLRLKPYSDRYPLHLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQIVS 182 + L+L+ Y DR P LSGGQ+QRVAI RA++ P V LFDEP + LD ++ Q+ Sbjct: 115 AEAARVLQLEDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRV 174 Query: 183 IIREL-AETNITQVIVTHEVEVARKTASRVVYMENGHIVEQG 223 + L + T + VTH+ A A ++V + G I + G Sbjct: 175 ELEGLHKQLGATMIYVTHDQVEAMTMADKIVVLNRGRIEQVG 216 Lambda K H 0.320 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 338 Length adjustment: 26 Effective length of query: 216 Effective length of database: 312 Effective search space: 67392 Effective search space used: 67392 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory