Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized)
to candidate 3608018 Dshi_1425 aldehyde dehydrogenase (RefSeq)
Query= BRENDA::P76217 (492 letters) >FitnessBrowser__Dino:3608018 Length = 484 Score = 183 bits (465), Expect = 1e-50 Identities = 144/447 (32%), Positives = 212/447 (47%), Gaps = 10/447 (2%) Query: 5 INGDWITGQGASRVKRNPVSGEVLWQGNDADAAQVEQACRAARAAFPRWARLSFAERHAV 64 ING + G+ V NP + EV+ +A QVEQA AA+AA P WA LS ER A Sbjct: 23 INGALVDSAGSFEVF-NPATDEVVAHAPNASRDQVEQAIAAAKAAQPGWAALSQDERGAY 81 Query: 65 VERFAALLESNKAELTAIIARETGKPRWE-AATEVTAMINKIAISIKAYHVRTGEQRSEM 123 + +A L+++K EL ++ E GKPR A TEV I + A E + Sbjct: 82 IAAYADALDAHKQELITLLTTEQGKPRHSMATTEVEYAI--FWVREVAKRRLEDEVIEDT 139 Query: 124 PDGAASLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAGNTIIFKPSELTPWSGEAVMRL 183 P+ + H P GV+ P+NFP L I P L+ GNT++ KPS TP + Sbjct: 140 PEHTVKVAHTPLGVVGAITPWNFPVLLGLWKIAPCLVTGNTMVMKPSPYTPLCTLRFGEI 199 Query: 184 WQQAGLPPGVLNLVQGGRETGQALSALEDLDGLLFTGSANTGYQLHRQLSGQPEKILALE 243 QQ P GVLN+V GG E G L+ D+ + FTGS TG ++ S ++I LE Sbjct: 200 AQQV-FPAGVLNVVAGGNEQGAWLTEHPDIAKISFTGSTATGRKVMASSSCNLKRI-TLE 257 Query: 244 MGGNNPLIIDEVADIDAAVHLTIQSAFVTAGQRCTCARRLLLKSGAQGDAFLARLVAVSQ 303 +GGN+P I+ D + +A+ +GQ C +RL + D FL VA + Sbjct: 258 LGGNDPAILLPGTDYKPLIPTLFDAAYGNSGQWCIAVKRLYVHESLYDD-FLRDFVAHAA 316 Query: 304 RLTPGNWDDEPQPFIGGLISEQAAQQVVTAWQQLEAMGGRPLLAPRLLQAGTSLLTPGII 363 T GN D P +G + ++ ++ + ++A G L + + + I+ Sbjct: 317 EKTVGNGMD-PNTDLGPIQNKMQYGKLKDLFADVKAQGLSVPLGGEIPDGPGNFVPITIV 375 Query: 364 EMTGV-AGVPDEEVFGPLLRVWRYDTFDEAIRMANNTRFGLSCGLVSPEREKFDQLLLEA 422 + + V EE FGP+L + ++ DE +R AN+T FGL+ + P+R+ + Sbjct: 376 DNPPKDSRVVREEPFGPILPIIKWSDLDEVVRDANDTEFGLAASVWGPDRDTAIGVANRL 435 Query: 423 RAGIVNWNKPLTGAASTAPFGGIGASG 449 AG V W + PFGG SG Sbjct: 436 EAGTV-WVNEIHIHGIDIPFGGHKQSG 461 Lambda K H 0.318 0.134 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 611 Number of extensions: 30 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 492 Length of database: 484 Length adjustment: 34 Effective length of query: 458 Effective length of database: 450 Effective search space: 206100 Effective search space used: 206100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory