GapMind for catabolism of small carbon sources

 

Aligments for a candidate for astD in Dinoroseobacter shibae DFL-12

Align N-succinylglutamate 5-semialdehyde dehydrogenase 1; EC 1.2.1.71; Succinylglutamic semialdehyde dehydrogenase 1; SGSD 1 (uncharacterized)
to candidate 3609638 Dshi_3021 aldehyde dehydrogenase (RefSeq)

Query= curated2:Q9AAL5
         (472 letters)



>lcl|FitnessBrowser__Dino:3609638 Dshi_3021 aldehyde dehydrogenase
           (RefSeq)
          Length = 485

 Score =  199 bits (505), Expect = 2e-55
 Identities = 149/444 (33%), Positives = 206/444 (46%), Gaps = 13/444 (2%)

Query: 10  DPYTGEAIADFAVNDARSIDAACHSARAAF-AEWAMTPLAERRAIALRFAETVRARREEI 68
           DP  G  +A  A   A  ID A  +ARAA   +W      ER     R    V    + +
Sbjct: 33  DPSDGTPLAQIARGGAAEIDRAVAAARAALDGDWGRMSATERGRCLTRLGALVAGEVDRL 92

Query: 69  ATLIARETGKPMWEALTEADSVAAKVAISIRAQDERAGERSEPMADATARLAHRPHGVLA 128
           A + AR+ GKP+ +A  +A ++A  +     A D+  GE     +  T      PHGV  
Sbjct: 93  AEMEARDVGKPLSQARADALALARYLEFYGGAADKVMGETIPYQSGYTVYTLREPHGVTG 152

Query: 129 VIGPFNFPMHLANGHIVPALLAGNAVVFKPSEKTPACGQLMGELWRAAGLPDHVLTIVIG 188
            I P+N+PM +    +  AL  GNA V KP+E           L  AAGLP   L +V G
Sbjct: 153 HIVPWNYPMQIIGRSVGAALAMGNACVLKPAEDACLTALAFARLAEAAGLPPGALNVVTG 212

Query: 189 -GGEAGEALVRHEALDGVLFTGGVQAGRAIHRALADAPHKILALELGGNAPLVVWDVADI 247
            G EAG AL  H  +D + FTG V  G  + +A A      + LELGG +P +V+  AD+
Sbjct: 213 LGAEAGAALSDHPGVDHLSFTGSVPVGAEV-QATAARHITPVTLELGGKSPQIVFADADL 271

Query: 248 EAAAHLIVQSAYVTAGQRCTCARRLILPEGARGDALLEALTMLMDRLVIGGPFQSPA--P 305
           +AA   +V+     AGQ C+ A R+++      DA+ + +      L +G     PA  P
Sbjct: 272 DAALPFLVKGGVQNAGQTCSAAARILVQTDV-FDAVADRMAEAYRALTVGPALSDPAVGP 330

Query: 306 FMGPVIDAHAAAQVLAAQ-DRMTADGGRPLRLAAVREARSALLSPGLIE--LTDAPLRDE 362
            + P   A  +A +  AQ D++ A G     L          + P L+     D PL  +
Sbjct: 331 LISPKQKARVSAMLAQAQPDQILATG----HLLPEAPEGGCYVLPHLLGGIAADHPLAQQ 386

Query: 363 EIFGPLLQVRRAADFDAALALANATRFGLAAGLISDDEALYRRFWTSVRAGIVNWNRPTT 422
           EIFGP+  + R      A+ALAN T FGL AG+ + D A   R    +RAG V  N    
Sbjct: 387 EIFGPVQILMRFETEQEAIALANGTEFGLVAGIWTRDGARQMRMPKRLRAGQVFVNTYGA 446

Query: 423 GASSAAPFGGVGGSGNHRPSAYYA 446
           G     PFGGVG SG+ R   + A
Sbjct: 447 GGGVELPFGGVGKSGHGREKGFEA 470


Lambda     K      H
   0.320    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 630
Number of extensions: 36
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 472
Length of database: 485
Length adjustment: 34
Effective length of query: 438
Effective length of database: 451
Effective search space:   197538
Effective search space used:   197538
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory