GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gabD in Dinoroseobacter shibae DFL-12

Align 4-(gamma-glutamylamino)butanal dehydrogenase (EC 1.2.1.99) (characterized)
to candidate 3609634 Dshi_3017 aldehyde dehydrogenase (RefSeq)

Query= BRENDA::P23883
         (495 letters)



>lcl|FitnessBrowser__Dino:3609634 Dshi_3017 aldehyde dehydrogenase
           (RefSeq)
          Length = 780

 Score =  306 bits (784), Expect = 2e-87
 Identities = 184/464 (39%), Positives = 264/464 (56%), Gaps = 19/464 (4%)

Query: 22  LFINGEYTAAAENETFETVDPVTQAPLAKIARGKSVDIDRAMSAARGVFERGDWSLSSPA 81
           +FI G  T  A  +TF T +P     LA++ +G   DI+ A++AAR    +  W+     
Sbjct: 35  VFIGG--TFQAPGKTFATRNPARGTELAQVTQGTEADIEAAVTAARRA--QPAWARLGGQ 90

Query: 82  KRKAVLNKLADLMEAHAEELALLETLDTGKPIRHSLRDDIPGAARAIRWYAEAIDKVYGE 141
               VL  +A L++ H+   A+LETLD GKPIR S   DIP A R   ++A     +  E
Sbjct: 91  GWARVLYAIARLLQKHSRLFAVLETLDNGKPIRESRDIDIPLAQRHFYYHAGMAALMEDE 150

Query: 142 VATTSSHELAMIVREPVGVIAAIVPWNFPLLLTCWKLGPALAAGNSVILKPSEKSPLSAI 201
           +            R PVGV   IVPWNFPLL+  WK+ PALA GN+V+LKP+E +PL+A+
Sbjct: 151 LPD----------RVPVGVCGQIVPWNFPLLMLAWKIAPALAMGNTVVLKPAEWTPLTAL 200

Query: 202 RLAGLAKEAGLPDGVLNVVTGFGHEAGQALSRHNDIDAIAFTGSTRTGKQLLKDAGDSNM 261
             A +  EAG+P GV+N+VTG G   G AL  H  +D IAFTGST  G+++ +    +  
Sbjct: 201 LFAEICGEAGVPPGVVNIVTGDG-ATGAALVSHPGVDKIAFTGSTDVGREIRRATAGTG- 258

Query: 262 KRVWLEAGGKSANIVFADCPDLQQAASATAAGIFYNQGQVCIAGTRLLLEESIADEFLAL 321
           K + LE GGKS  +VF D  DL  A       I++NQGQVC AG+RLL++E IA+ F A 
Sbjct: 259 KALTLELGGKSPYVVFEDA-DLDSAVEGLVDAIWFNQGQVCCAGSRLLVQEGIAEAFYAK 317

Query: 322 LKQQAQNWQPGHPLDPATTMGTLIDCAHADSVHSFIREGESKGQLLLDGRNAGLAAAIGP 381
           L+ +    + G PLD    +G ++D AH   V   +    S G++   G      A   P
Sbjct: 318 LRARMATLRIGDPLDKCIDVGAMVDPAHCAKVAEMV--AGSNGEVHQPGTVPAEGAFYPP 375

Query: 382 TIFVDVDPNASLSREEIFGPVLVVTRFTSEEQALQLANDSQYGLGAAVWTRDLSRAHRMS 441
           T+   ++P   L R+EIFGPVLV T F +  +A+++AN ++YGL A +W+ +++RA  ++
Sbjct: 376 TLITGLEPADPLMRDEIFGPVLVATTFRTPAEAVEVANATRYGLAATLWSENINRALDIA 435

Query: 442 RRLKAGSVFVNNYNDGDMTVPFGGYKQSGNGRDKSLHALEKFTE 485
            +L AG V+VN  N  D    FGG ++SG GR+     L  +T+
Sbjct: 436 PKLAAGVVWVNATNLFDAAAGFGGVRESGFGREGGWEGLRAYTK 479



 Score = 95.9 bits (237), Expect = 5e-24
 Identities = 72/223 (32%), Positives = 107/223 (47%), Gaps = 7/223 (3%)

Query: 48  LAKIARGKSVDIDRAMSAARGVFERGDWSLSSPAKRKAVLNKLADLMEAHAEELALLETL 107
           L     G   DI  A+ AA G      W  ++   R  +L  +A+ + A  EE A     
Sbjct: 535 LGHAPEGSRKDIRNAVEAATGA---ASWGRTTGHLRAQILYYVAENLSARTEEFATRIAE 591

Query: 108 DTGKPIRHSLRDDIPGAARAIRWYAEAIDKVYGEVATTSSHELAMIVREPVGVIAAIVPW 167
            TG  +  +   ++  A   +  YA   DK  G V       +A+ + EPVGVI A  P 
Sbjct: 592 MTGSRVPRA-EAEVSAAIDRLFTYAAWADKYDGAVKPVPIRGVALAMPEPVGVIGAFAPD 650

Query: 168 NFPLLLTCWKLGPALAAGNSVILKPSEKSPLSAIRLAGLAKEAGLPDGVLNVVTGFGHEA 227
           + PLL     LG ALA GN ++L PSE  PL+A  L  +   + +P GV+N+VTG     
Sbjct: 651 DAPLLGAVSILGAALAMGNRLVLVPSEPFPLAATDLYQVLDTSDVPAGVVNIVTGAHEAL 710

Query: 228 GQALSRHNDIDAI-AFTGSTRTGKQLLKDAGDSNMKRVWLEAG 269
            + L+ H  +DA+ +F+G+  +     + AG  N+KR W+  G
Sbjct: 711 AKPLASHLGVDAVWSFSGADISTTIEAEAAG--NLKRTWVNHG 751


Lambda     K      H
   0.317    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 941
Number of extensions: 58
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 495
Length of database: 780
Length adjustment: 37
Effective length of query: 458
Effective length of database: 743
Effective search space:   340294
Effective search space used:   340294
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory