Align glutaryl-CoA dehydrogenase (EC 1.3.8.6) (characterized)
to candidate 3608967 Dshi_2357 acyl-CoA dehydrogenase domain protein (RefSeq)
Query= metacyc::G1G01-166-MONOMER (393 letters) >FitnessBrowser__Dino:3608967 Length = 406 Score = 555 bits (1430), Expect = e-163 Identities = 276/391 (70%), Positives = 313/391 (80%), Gaps = 2/391 (0%) Query: 5 ASFNWIDPLLLDQQLTEEERMVRDSAYQFAQDKLAPRVLEAFRHEQTDPAIFREMGEVGL 64 A F+W DPL L+ QL+EEERM+RD FA DKLAPRV++A+R P IF EMG GL Sbjct: 16 AGFDWPDPLRLEDQLSEEERMLRDGGAAFAADKLAPRVIDAYREATVAPEIFSEMGAAGL 75 Query: 65 LGATIPEQYGGSGLNYVCYGLIAREVERIDSGYRSMMSVQSSLVMVPINEFGTEAQKQKY 124 LG T+PE YGG G +YV YGL+ARE+ERIDSGYRSMMSVQSSLVM PI+ +GTE Q+QKY Sbjct: 76 LGITVPEAYGGLGGSYVAYGLVAREIERIDSGYRSMMSVQSSLVMYPIHAYGTEEQRQKY 135 Query: 125 LPKLASGEWIGCFGLTEPNHGSDPGSMITRARKVDGGYRLTGSKMWITNSPIADVFVVWA 184 LP LA+G IGCFGLTEP+ GSDP M TRA K GYRLTGSKMWI+NSPIADVFVVWA Sbjct: 136 LPGLAAGTLIGCFGLTEPDAGSDPAGMKTRAEKTPTGYRLTGSKMWISNSPIADVFVVWA 195 Query: 185 KDDA--GDIRGFVLEKGWQGLSAPAIHGKVGLRASITGEIVMDNVFVPEENIFPDVRGLK 242 K +A G IRGFVL+KG GLSAP + GK+ LRAS+TGEIVMD V V E+ + P V GLK Sbjct: 196 KSEAHGGKIRGFVLDKGTPGLSAPKVGGKLSLRASVTGEIVMDGVEVGEDALLPGVEGLK 255 Query: 243 GPFTCLNSARYGISWGALGAAEACWHTARQYTLDRQQFGRPLAANQLIQKKLADMQTEIT 302 GPF CLN ARYGI WG +GA+E CWH ARQY LDR QF RPLA QL QKKLADMQTEI Sbjct: 256 GPFGCLNRARYGIGWGVMGASEFCWHAARQYGLDRHQFKRPLAQTQLFQKKLADMQTEIA 315 Query: 303 LALQGCLRLGRMKDEGTAAVEITSIMKRNSCGKALDIARMARDMLGGNGISDEFGVARHL 362 L LQ LR+GR+ DEG AA E+ S++KRN+CGKAL+IAR ARDM GGNGIS+EF V RH+ Sbjct: 316 LGLQAALRVGRLMDEGRAAPEMISLLKRNNCGKALEIARAARDMHGGNGISEEFQVMRHM 375 Query: 363 VNLEVVNTYEGTHDVHALILGRAQTGIQAFY 393 VNLE VNTYEGTHDVHALILGRAQTG+QAF+ Sbjct: 376 VNLETVNTYEGTHDVHALILGRAQTGLQAFF 406 Lambda K H 0.320 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 550 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 406 Length adjustment: 31 Effective length of query: 362 Effective length of database: 375 Effective search space: 135750 Effective search space used: 135750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory