Align Lysine/ornithine decarboxylase; LDC; EC 4.1.1.17; EC 4.1.1.18 (uncharacterized)
to candidate 3607967 Dshi_1375 Ornithine decarboxylase (RefSeq)
Query= curated2:O50657 (393 letters) >FitnessBrowser__Dino:3607967 Length = 398 Score = 157 bits (398), Expect = 4e-43 Identities = 111/352 (31%), Positives = 162/352 (46%), Gaps = 10/352 (2%) Query: 21 PFLVASLDKVEENYQFMRRHLPRAG-VFYAMKANPTPEILSLLAGLGSHFDVASAGEMEI 79 P LV D V Y + L + + YAMKANP PEIL LA G FD AS GE+E+ Sbjct: 40 PTLVLDCDAVVAKYHALAHGLGQGTLIHYAMKANPAPEILRALAAEGCGFDAASRGEIEL 99 Query: 80 LHELGVDGSQMIYANPVKDARGLKAAADYNVRRFTFDDPSEIDKMAKAVPGADVLVRIAV 139 G +++ + N +K + A + + F D +E+DK+A PGA V +R+ V Sbjct: 100 ALAAGATAARISFGNTIKRPSDIAFAHAHGIDLFAADAEAELDKIAAHAPGARVFLRVLV 159 Query: 140 RNNKALVDLNTKFGAPVEEALDLLKAAQDAGLHAMGICFHVGSQSLSTAAYEEALLVARR 199 A L+ KFG + AL L+ A GL +G+ FHVGSQ+ + + L Sbjct: 160 GATGADWPLSRKFGCAPDTALRLMDRAAFLGLRPVGLSFHVGSQTRDPGMWSDTLDQMAE 219 Query: 200 LFDEAEEMGMHLTDLDIGGGFPVPDAKGLNVDLAAMMEAINKQIDRLFPDTAVWTEPGRY 259 ++ G L ++IGGGFP + ++ + + F D V EPGR Sbjct: 220 IWHAGRARGHDLNLINIGGGFPAFYGDPI-LEAETYAGRVGALVRARFGDATVMAEPGRG 278 Query: 260 MCGTAVNLVTSVIGTKTRGEQP---WYILDEGIYGCFSGIMYDHWTYP-LHCFGKGNKKP 315 + A +V V+ + E W LD G + + M + Y + G P Sbjct: 279 LVAEAGMIVAEVLLVSRKSEDDLCRWVYLDIGKFSGLAETMEEAIRYQFVTPHDGGETGP 338 Query: 316 STFGGPSCDGIDVLYRD---FMAPELKIGDKVLVTEMGSYTSV-SATRFNGF 363 GPSCD DVLY + L+ GD++L+ G+YT+ S+ FNGF Sbjct: 339 CIMAGPSCDSADVLYEQRPVHLPMALQSGDRILIKATGAYTTTYSSVGFNGF 390 Lambda K H 0.320 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 398 Length adjustment: 31 Effective length of query: 362 Effective length of database: 367 Effective search space: 132854 Effective search space used: 132854 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory