Align arginase subunit (EC 3.5.3.1) (characterized)
to candidate 3608918 Dshi_2309 arginase (RefSeq)
Query= metacyc::MONOMER-11552 (324 letters) >FitnessBrowser__Dino:3608918 Length = 308 Score = 350 bits (897), Expect = e-101 Identities = 179/302 (59%), Positives = 216/302 (71%), Gaps = 4/302 (1%) Query: 21 CQILGAPVQSGASQPGCLMGPDAFRTAGLTQVLTELGWAVTDLGDAT-PTVEPELSHPNS 79 C ++GA + G + GCLMGPDA+RTAGL L +LGW D G+ PT + P Sbjct: 6 CILIGAGMDCGKRRRGCLMGPDAYRTAGLIDTLGDLGWQTEDRGNLPGPTWVADT--PPG 63 Query: 80 AVKNLDALVGWTRSLSQKALEMARSCDLPVFLGGDHSMSAGTVSGVAQRTAELGKEQFVL 139 + L + WTR LS+ A + A P+FLGGDH++S GTV+GV+ A + FVL Sbjct: 64 ELHALSETITWTRLLSEAA-QAAIGQGFPIFLGGDHALSLGTVAGVSAHAAGQDRPLFVL 122 Query: 140 WLDAHTDLHTLHTTASGNLHGTPVAYYTGQSGFEGLPPLAAPVNPRNVSMMGIRSVDPEE 199 WLDAH D++T TT SGNLHGTPVAY TGQ+GF+G P L APV P N+ +G+RSVD E Sbjct: 123 WLDAHPDINTPTTTLSGNLHGTPVAYITGQAGFDGFPTLTAPVPPENICFIGLRSVDASE 182 Query: 200 RRRVAEIGVQVADMRVLDEQGVVRPLEAFLDRVSKVSGRLHVSLDVDFLDPAIAPAVGTT 259 R +A+ G+ DMR +DE G+ PL AFL RV+ G LHVSLDVDFL+PAIAPAVGTT Sbjct: 183 RNFIAQSGMTAIDMRQIDEHGIAAPLSAFLARVATAGGMLHVSLDVDFLEPAIAPAVGTT 242 Query: 260 VPGGATFREAHLIMEMLHDSGLVTSLDLAELNPFLDERGRTARLITDLASSLFGRRVFDR 319 VPGGATFREAHL+MEMLHDSGLV+SLDL ELNPFLD+RGRTA L+ DL +SLFGRRVFDR Sbjct: 243 VPGGATFREAHLVMEMLHDSGLVSSLDLVELNPFLDDRGRTASLMVDLTASLFGRRVFDR 302 Query: 320 VT 321 T Sbjct: 303 PT 304 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 344 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 308 Length adjustment: 27 Effective length of query: 297 Effective length of database: 281 Effective search space: 83457 Effective search space used: 83457 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate 3608918 Dshi_2309 (arginase (RefSeq))
to HMM TIGR01229 (rocF: arginase (EC 3.5.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01229.hmm # target sequence database: /tmp/gapView.18627.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01229 [M=300] Accession: TIGR01229 Description: rocF_arginase: arginase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-91 293.2 0.0 1.3e-91 293.0 0.0 1.0 1 lcl|FitnessBrowser__Dino:3608918 Dshi_2309 arginase (RefSeq) Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3608918 Dshi_2309 arginase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 293.0 0.0 1.3e-91 1.3e-91 2 298 .. 8 298 .. 7 300 .. 0.96 Alignments for each domain: == domain 1 score: 293.0 bits; conditional E-value: 1.3e-91 TIGR01229 2 ivglpfseGqgkrGvdkGpkalreaglleklkdlekevedlgqvaaaklekesdreavkaersvlaakeklaekvkk 78 ++g++++ G+ +rG+ +Gp+a+r agl+++l+dl+ + ed g+++ + + +++ +++a+ ++++ l+e+++ lcl|FitnessBrowser__Dino:3608918 8 LIGAGMDCGKRRRGCLMGPDAYRTAGLIDTLGDLGWQTEDRGNLPGPTWVADTPPGELHALSETITWTRLLSEAAQA 84 89*******************************************99****************************** PP TIGR01229 79 vveekrfplvLggdHsiaiGtvsgvakka..kdkklgvlwlDAHaDintletstSgnlHGmPlafllgrlkkevedl 153 + ++ fp++LggdH++ +Gtv+gv +a +d+ l+vlwlDAH Dint+ t+ SgnlHG+P+a+++g+++++ + lcl|FitnessBrowser__Dino:3608918 85 AIGQG-FPIFLGGDHALSLGTVAGVSAHAagQDRPLFVLWLDAHPDINTPTTTLSGNLHGTPVAYITGQAGFDG--F 158 **999.*******************9887235779*********************************988888..7 PP TIGR01229 154 eelkllkgkeispkklvyiGlRdvdegErkilkelgikvfsmkeidklGiakvvektleslkaed.pihlSlDvDgl 229 + l+++ + p+++++iGlR+vd++Er+ + ++g+++ +m++id++Gia+ + +l+++ + ++h+SlDvD+l lcl|FitnessBrowser__Dino:3608918 159 PT--LTAP--VPPENICFIGLRSVDASERNFIAQSGMTAIDMRQIDEHGIAAPLSAFLARVATAGgMLHVSLDVDFL 231 87..4445..99*************************************************99988*********** PP TIGR01229 230 DpklapatGtpvrgGltfrEgklilelllesglltaldlvEvNPtldikeksetikaavelvesllget 298 +p +apa+Gt+v+gG+tfrE++l++e+l++sgl+++ldlvE+NP+ld ++++t++ +v+l++sl+g+ lcl|FitnessBrowser__Dino:3608918 232 EPAIAPAVGTTVPGGATFREAHLVMEMLHDSGLVSSLDLVELNPFLD--DRGRTASLMVDLTASLFGRR 298 ***********************************************..*****************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (300 nodes) Target sequences: 1 (308 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 11.48 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory