Align Agmatinase; Agmatine ureohydrolase; AUH; EC 3.5.3.11 (characterized)
to candidate 3608333 Dshi_1735 putative agmatinase (RefSeq)
Query= SwissProt::Q7X3P1 (306 letters) >FitnessBrowser__Dino:3608333 Length = 324 Score = 251 bits (640), Expect = 2e-71 Identities = 135/288 (46%), Positives = 185/288 (64%), Gaps = 5/288 (1%) Query: 18 AFGFLRFPLNFQPYSSDADWVITGVPFDMATSGRAGTRHGPGAIRQISTNLAWEGHRWPW 77 A FLR + S D ++GVPFD++ + R G R GP AIR+ S+ ++ + W Sbjct: 31 ALSFLR--RRYTKELSGVDVAVSGVPFDLSVTNRPGCRLGPRAIREASSLQPFDPP-YGW 87 Query: 78 HFDMRERLKVVDCGDLVFNFGDAQDMSDKLQAHTEKLLAAGKRCLTFGGDHFVTLPLLRA 137 FD VVD GDL F++G A L+AH +LAAG LT GGDH+++ P+LRA Sbjct: 88 GFDPLSEFTVVDYGDLAFDYGRAAGFPAALEAHIRTILAAGAAPLTMGGDHYISYPILRA 147 Query: 138 HAKHFGKMALVHFDAHTDTYANGSK--FDHGTMFYHAPNEGLIDPQHSVQIGIRTEHDTN 195 A+ G ++L+ FDAH+DT+ + + DHGTMFY A +GLIDP SVQ+GIRT +DT+ Sbjct: 148 LAEVHGPLSLLQFDAHSDTWPDEDRDRLDHGTMFYKAVKDGLIDPARSVQVGIRTTNDTD 207 Query: 196 NGFTVLDAAQVNDRGVDDLVAQIKEIVGSLPVYLTFDIDCLDPAFAPGTGTPVVGGLTTD 255 GF V+DA +V++ G + A+++ I+G YLTFDIDCLDP APGTGTPV GGL+ Sbjct: 208 LGFHVIDAREVHEAGAAAVAAKVRGILGDHKTYLTFDIDCLDPGTAPGTGTPVWGGLSAG 267 Query: 256 KALKMLRALQPLNIVGMDLVEVSPAYDQSDITALAGATIALDMLYLQA 303 +A +LR L + +VG D+VEVSP YD S TA+AGA + ++L L A Sbjct: 268 QAAILLRDLAGITVVGGDVVEVSPPYDPSGATAVAGAHVMTEILCLWA 315 Lambda K H 0.321 0.138 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 330 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 306 Length of database: 324 Length adjustment: 27 Effective length of query: 279 Effective length of database: 297 Effective search space: 82863 Effective search space used: 82863 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate 3608333 Dshi_1735 (putative agmatinase (RefSeq))
to HMM TIGR01230 (speB: agmatinase (EC 3.5.3.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01230.hmm # target sequence database: /tmp/gapView.6071.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01230 [M=275] Accession: TIGR01230 Description: agmatinase: agmatinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-64 204.4 0.0 1.6e-64 204.1 0.0 1.0 1 lcl|FitnessBrowser__Dino:3608333 Dshi_1735 putative agmatinase (R Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3608333 Dshi_1735 putative agmatinase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 204.1 0.0 1.6e-64 1.6e-64 12 274 .. 45 312 .. 34 313 .. 0.95 Alignments for each domain: == domain 1 score: 204.1 bits; conditional E-value: 1.6e-64 TIGR01230 12 eAevvivgiPydattsyrpGsrhgpeaireastnLeayseeldrdlal...lkvvDagdlplaaGdaremvekieev 85 +v + g+P+d ++ rpG+r gp aireas L+ +++ +++ ++ vvD gdl + +G a +e++ lcl|FitnessBrowser__Dino:3608333 45 GVDVAVSGVPFDLSVTNRPGCRLGPRAIREAS-SLQPFDPPYGWGFDPlseFTVVDYGDLAFDYGRAAGFPAALEAH 120 568999*************************9.59********8877655599************************ PP TIGR01230 86 veelleegkfvvaiGGeHsitlpvirAvkkkfeklavvqfDAHtDlr.....defegeklshacvmrrvlelglnvl 157 ++ +l++g ++++GG+H i++p++rA ++ +++l ++qfDAH D+ d +++++++ +v+ +++++ +++ lcl|FitnessBrowser__Dino:3608333 121 IRTILAAGAAPLTMGGDHYISYPILRALAEVHGPLSLLQFDAHSDTWpdedrDRLDHGTMFYKAVKDGLIDPA-RSV 196 *********************************************977666699******************9.9** PP TIGR01230 158 qigiRsgikeeadlarennikvlkreledeiaevlakvldkpvyvtiDiDvlDPafaPGvgtpepgGltskellklf 234 q+giR+ + + ++ + ++ +v + + + a+v ++ d++ y+t+DiD+lDP+ aPG+gtp+ gGl+ ++ + lcl|FitnessBrowser__Dino:3608333 197 QVGIRTTNDTDLGFHVIDAREVHEAGAAAVAAKVRGILGDHKTYLTFDIDCLDPGTAPGTGTPVWGGLSAGQAAI-L 272 *********************************************************************998865.8 PP TIGR01230 235 vlaekekkvvGlDvvEvaPvydssevtaltaaklalelll 274 ++ vvG DvvEv+P yd s ta++ a ++ e+l lcl|FitnessBrowser__Dino:3608333 273 LRDLAGITVVGGDVVEVSPPYDPSGATAVAGAHVMTEILC 312 99999******************************99985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (275 nodes) Target sequences: 1 (324 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.85 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory