Align ATPase (characterized, see rationale)
to candidate 3607933 Dshi_1341 ABC transporter related (RefSeq)
Query= uniprot:Q31RN8 (261 letters) >FitnessBrowser__Dino:3607933 Length = 362 Score = 152 bits (383), Expect = 1e-41 Identities = 88/224 (39%), Positives = 131/224 (58%), Gaps = 11/224 (4%) Query: 41 VSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIWIEGHRLSHDRRDIATIRQEV 100 VS+ V G+V ++GPSG GKST LR + ++ G + ++G +S D + + V Sbjct: 27 VSIRVMPGQVTCLLGPSGCGKSTTLRIIAGVDRQDSGTLTVDGEVVSSDDIHLPPEARSV 86 Query: 101 GMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATARQLLERVRIAEQADKYPGQLSG 160 G++FQ F LFPHL V N+ R+ + A A +LL+RV + A K+P QLSG Sbjct: 87 GLMFQDFALFPHLCVADNVGFGLSGSRK----EKRARAHELLDRVGLLGDAGKFPHQLSG 142 Query: 161 GQQQRVAIARALAMQPRILLFDEPTSALDPEM---VR-EVLDVMRDLASEGMTMLVATHE 216 G+QQRVA+ARA+A +PR++L DEP S LD + +R E L+V++D EG +L+ THE Sbjct: 143 GEQQRVALARAIAPRPRVMLMDEPFSGLDNRLRDGIRDETLEVLKD---EGTAVLLVTHE 199 Query: 217 VGFAREVADRVVLMADGQIVEEAPPDRFFTAPQSDRAKQFLAQI 260 A +AD + LM G+IV++ P + +P A F + I Sbjct: 200 PEEAMRMADNIALMRGGKIVQQGAPYNVYNSPVDKAAAAFFSDI 243 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 259 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 362 Length adjustment: 27 Effective length of query: 234 Effective length of database: 335 Effective search space: 78390 Effective search space used: 78390 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory