GapMind for catabolism of small carbon sources

 

Aligments for a candidate for natF in Dinoroseobacter shibae DFL-12

Align Extracellular solute-binding protein, family 3 (characterized, see rationale)
to candidate 3606888 Dshi_0318 cationic amino acid ABC transporter, periplasmic binding protein (RefSeq)

Query= uniprot:Q31RP1
         (359 letters)



>lcl|FitnessBrowser__Dino:3606888 Dshi_0318 cationic amino acid ABC
           transporter, periplasmic binding protein (RefSeq)
          Length = 338

 Score =  299 bits (766), Expect = 6e-86
 Identities = 145/316 (45%), Positives = 201/316 (63%), Gaps = 3/316 (0%)

Query: 45  LNQVQARGKLLCGVEGRLPGFSFLDSQGNYSGLDVDICKAIAAALFNDPKAIEYRSLDSV 104
           L +VQARG + CG+   L GF+  D+ G + G DV +C+A+AAA+F DP A+ +  + + 
Sbjct: 25  LEEVQARGAVNCGISTGLVGFASQDANGEWQGFDVAVCRAVAAAVFGDPTAVNFNPVTNQ 84

Query: 105 ERFPALASGEVDLLSRNTTWTLSRDAKGGNNLEFAPTTFYDGQGLMVRRNSGIQSLQDFQ 164
            RF  L SGE+D+L+RNTTWT SRD      LEF    +YDGQG MV +  G+ S  +  
Sbjct: 85  VRFEVLNSGEIDMLARNTTWTFSRDVD--LKLEFTGINYYDGQGFMVPKALGVSSATELD 142

Query: 165 GKSICVETGTTSELNLADTMRELGVQYQEIKFPNSDANYAAYAQGRCEGVTSDRSQLAAR 224
           G ++C++ GTT+ELNLAD  R   + ++ +    +      Y  G C+  T+D S LAA 
Sbjct: 143 GATVCIQKGTTTELNLADFFRANNISFEPVPISTASEAQQQYLAGACDVYTTDASGLAAT 202

Query: 225 RTTLSDADQHQLLDAVISKEPLSPATLNNDSPWFDVVKWVVNATIQAEEFGITQANIDQF 284
           R +    D+H +L  +ISKEPL P   + D+ W D+V+W +NA I AEE G+T AN+ + 
Sbjct: 203 RASFESPDEHVVLPEIISKEPLGPLVRHGDNEWGDIVRWTLNALIAAEELGVTSANVAEL 262

Query: 285 KT-SKNPEIRRFLGLEGELGQQLGLSNDFAYRAIKAVGNYGEIYERNVGQQSPLKLNRGL 343
              + NPEI R LG EG LG+QLGLS D+A   IKA GNYGEI+E ++G+ +P+ L RGL
Sbjct: 263 AAGTDNPEINRLLGTEGNLGEQLGLSADWAVNVIKAGGNYGEIFETHIGENTPIGLARGL 322

Query: 344 NQLYKNGGLLYSPPFR 359
           N  +  GGLLY+PPFR
Sbjct: 323 NAQWTEGGLLYAPPFR 338


Lambda     K      H
   0.317    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 299
Number of extensions: 11
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 359
Length of database: 338
Length adjustment: 29
Effective length of query: 330
Effective length of database: 309
Effective search space:   101970
Effective search space used:   101970
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory