Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate 3608829 Dshi_2221 ABC transporter related (RefSeq)
Query= TCDB::A3ZI83 (242 letters) >FitnessBrowser__Dino:3608829 Length = 259 Score = 191 bits (486), Expect = 9e-54 Identities = 106/248 (42%), Positives = 154/248 (62%), Gaps = 14/248 (5%) Query: 1 MIELKNVNKYYGTHHVLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGEVV- 59 +IE+++++K YG VLK +++ + G+ + +IG SGSGKST +RC N LE+ G+V+ Sbjct: 8 VIEIRDLHKAYGALEVLKGVSIRAERGDVVSLIGSSGSGKSTLLRCCNLLEDSQRGDVLF 67 Query: 60 -----------VNNLVLNHKNKIEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKS 108 ++ + K I I R +MVFQ FNL+ HMT+L+N+ AP+ + + Sbjct: 68 CGEPVTWTGSGLDRRPADKKQVIRI-RTNLSMVFQQFNLWAHMTILENVMEAPVTVLGEP 126 Query: 109 KKEAEETAFKYLKVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDP 168 KE E A L VG+ DK + YPA LSGGQQQR AIAR L + +LFDEPTSALDP Sbjct: 127 PKEVEARARALLDKVGIGDKCDAYPAQLSGGQQQRAAIARGLAMEPKALLFDEPTSALDP 186 Query: 169 ETIQEVLDVMKEISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENIPSEFFSNPK 228 E QEV+ V+K+++ + TM++VTH+M A +V+D ++F+ G I EE P F PK Sbjct: 187 ELEQEVVKVIKDLAAEGR-TMLIVTHDMRLAADVSDHVVFLHQGLIEEEGPPDILFGQPK 245 Query: 229 TERARLFL 236 + R + FL Sbjct: 246 SARLKQFL 253 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 259 Length adjustment: 24 Effective length of query: 218 Effective length of database: 235 Effective search space: 51230 Effective search space used: 51230 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory