Align Glutamate/aspartate import permease protein GltK (characterized)
to candidate 3606889 Dshi_0319 polar amino acid ABC transporter, inner membrane subunit (RefSeq)
Query= SwissProt::P0AER5 (224 letters) >FitnessBrowser__Dino:3606889 Length = 411 Score = 75.9 bits (185), Expect = 1e-18 Identities = 44/122 (36%), Positives = 72/122 (59%), Gaps = 1/122 (0%) Query: 97 LISAMVAFSMFEAAYYSEIIRAGIQSISRGQSSAALALGMTHWQSMKLIILPQAFRAMVP 156 LI+ A +++ A+ +E +RAGI ++S+GQ+ AA ALGM + M LIILPQA R ++P Sbjct: 279 LIALWFALALYTGAFIAENVRAGILAVSKGQTEAAAALGMRPNRIMSLIILPQALRVIIP 338 Query: 157 LLLTQGIVLFQDTSLVYVLSLADFFRTASTIG-ERDGTQVEMILFAGFVYFVISLSASLL 215 +++Q + L +++SL + D T + + G E +L Y +ISLS S L Sbjct: 339 PVISQYLNLTKNSSLAAAIGYMDLTGTLGGVTLNQTGRSFECVLLLMLFYLLISLSISAL 398 Query: 216 VS 217 ++ Sbjct: 399 MN 400 Score = 38.5 bits (88), Expect = 2e-07 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Query: 19 GLVITLKITVTAVVIGILWGTMLAVMRLSSFAPVAWFAKAYVNVFRSIPLVMVLLWFYLI 78 GL+ TL + + ++G + V+RLS VA YV +FR+IP VL+W +I Sbjct: 97 GLLNTLLVAFLGCITATIFGVLAGVLRLSKNWLVAKVMSVYVEIFRNIP---VLIWIVII 153 Lambda K H 0.330 0.140 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 2 Length of query: 224 Length of database: 411 Length adjustment: 27 Effective length of query: 197 Effective length of database: 384 Effective search space: 75648 Effective search space used: 75648 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory