Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate 3607646 Dshi_1055 ABC transporter related (RefSeq)
Query= TCDB::Q52666 (263 letters) >FitnessBrowser__Dino:3607646 Length = 366 Score = 154 bits (390), Expect = 2e-42 Identities = 85/239 (35%), Positives = 141/239 (58%), Gaps = 6/239 (2%) Query: 22 AIQISQMNKWYGQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQSGKIIV 81 A+++ ++K YG LR ++LT+ GE V+ GPSG GK+T++R I G++++ Sbjct: 8 AVEVKGLSKHYGPVKALRQVDLTIAAGEYFVLLGPSGGGKTTLLRTIGGFHRPTEGQVLL 67 Query: 82 DGIELTSDLKNIDKVRSEVGMVFQHFNLFPHLTILENLTLAPIWVRKVPKREAEETAMYY 141 G D+ ++ + MVFQ + LFPH+T+L+N++ + V + K A+E A Sbjct: 68 HG----RDMSHLPPDKRPTTMVFQAYALFPHMTVLQNVSYG-LKVAGMDKATAQEKAAAM 122 Query: 142 LEKVKIPEQAQKYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSALDPEMIKEVLDTMI 201 ++ V + A++ P +LSGGQQQRV +AR+L + I+L DEP +ALD ++ K++ + Sbjct: 123 MDVVGLAGFAERKPHELSGGQQQRVQLARALVLDRDILLLDEPLAALDAQLRKDMCLELK 182 Query: 202 QLAEE-GMTMLCVTHEMGFAQAVANRVIFMADGQIVEQNNPHDFFHNPQSERTKQFLSQ 259 L E+ G+T + VTH A VA+R+ +ADGQ+VEQ D + P + T F+ + Sbjct: 183 HLQEKVGITFIHVTHNQEEAMTVADRIALVADGQLVEQGAARDIYRAPIKKFTAGFVGE 241 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 366 Length adjustment: 27 Effective length of query: 236 Effective length of database: 339 Effective search space: 80004 Effective search space used: 80004 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory