Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate 3608030 Dshi_1437 glycine betaine/L-proline ABC transporter, ATPase subunit (RefSeq)
Query= TCDB::Q52666 (263 letters) >FitnessBrowser__Dino:3608030 Length = 351 Score = 152 bits (383), Expect = 1e-41 Identities = 82/224 (36%), Positives = 138/224 (61%), Gaps = 4/224 (1%) Query: 40 DINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQSGKIIVDGIELTS-DLKNIDKVRS 98 D++L+V RGE I G SGSGKST++R NRL E +G+I ++G ++ + + + + R+ Sbjct: 49 DVSLSVRRGEIFCIMGLSGSGKSTLVRHFNRLLEPTAGRIEIEGTDVMALGTQELQRFRN 108 Query: 99 -EVGMVFQHFNLFPHLTILENLTLAPIWVRKVPKREAEETAMYYLEKVKIPEQAQKYPGQ 157 ++GMVFQ+F L PH ++L+N+ + P+ +RKVPK E A L+ V++ K+ + Sbjct: 109 RQIGMVFQNFALMPHRSVLDNVAM-PLEIRKVPKNERMRQAAAILDIVELGAWGAKFAHE 167 Query: 158 LSGGQQQRVAIARSLCMKPKIMLFDEPTSALDPEMIKEVLDTMIQLAE-EGMTMLCVTHE 216 L GG QQRV +AR+L P ++L DEP SALDP + +++ D I+L++ T + +TH+ Sbjct: 168 LPGGMQQRVGLARALAANPDVLLMDEPFSALDPLIRRQLQDEFIRLSKILKKTTIFITHD 227 Query: 217 MGFAQAVANRVIFMADGQIVEQNNPHDFFHNPQSERTKQFLSQI 260 + A + +R+ M DG++V+ D +P + F++ I Sbjct: 228 LDEAVRIGDRIAIMRDGKVVQMGTAEDIVMHPADDYVADFVAGI 271 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 351 Length adjustment: 27 Effective length of query: 236 Effective length of database: 324 Effective search space: 76464 Effective search space used: 76464 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory