Align Extracellular solute-binding protein, family 3 (characterized, see rationale)
to candidate 3606888 Dshi_0318 cationic amino acid ABC transporter, periplasmic binding protein (RefSeq)
Query= uniprot:Q31RP1 (359 letters) >FitnessBrowser__Dino:3606888 Length = 338 Score = 299 bits (766), Expect = 6e-86 Identities = 145/316 (45%), Positives = 201/316 (63%), Gaps = 3/316 (0%) Query: 45 LNQVQARGKLLCGVEGRLPGFSFLDSQGNYSGLDVDICKAIAAALFNDPKAIEYRSLDSV 104 L +VQARG + CG+ L GF+ D+ G + G DV +C+A+AAA+F DP A+ + + + Sbjct: 25 LEEVQARGAVNCGISTGLVGFASQDANGEWQGFDVAVCRAVAAAVFGDPTAVNFNPVTNQ 84 Query: 105 ERFPALASGEVDLLSRNTTWTLSRDAKGGNNLEFAPTTFYDGQGLMVRRNSGIQSLQDFQ 164 RF L SGE+D+L+RNTTWT SRD LEF +YDGQG MV + G+ S + Sbjct: 85 VRFEVLNSGEIDMLARNTTWTFSRDVD--LKLEFTGINYYDGQGFMVPKALGVSSATELD 142 Query: 165 GKSICVETGTTSELNLADTMRELGVQYQEIKFPNSDANYAAYAQGRCEGVTSDRSQLAAR 224 G ++C++ GTT+ELNLAD R + ++ + + Y G C+ T+D S LAA Sbjct: 143 GATVCIQKGTTTELNLADFFRANNISFEPVPISTASEAQQQYLAGACDVYTTDASGLAAT 202 Query: 225 RTTLSDADQHQLLDAVISKEPLSPATLNNDSPWFDVVKWVVNATIQAEEFGITQANIDQF 284 R + D+H +L +ISKEPL P + D+ W D+V+W +NA I AEE G+T AN+ + Sbjct: 203 RASFESPDEHVVLPEIISKEPLGPLVRHGDNEWGDIVRWTLNALIAAEELGVTSANVAEL 262 Query: 285 KT-SKNPEIRRFLGLEGELGQQLGLSNDFAYRAIKAVGNYGEIYERNVGQQSPLKLNRGL 343 + NPEI R LG EG LG+QLGLS D+A IKA GNYGEI+E ++G+ +P+ L RGL Sbjct: 263 AAGTDNPEINRLLGTEGNLGEQLGLSADWAVNVIKAGGNYGEIFETHIGENTPIGLARGL 322 Query: 344 NQLYKNGGLLYSPPFR 359 N + GGLLY+PPFR Sbjct: 323 NAQWTEGGLLYAPPFR 338 Lambda K H 0.317 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 359 Length of database: 338 Length adjustment: 29 Effective length of query: 330 Effective length of database: 309 Effective search space: 101970 Effective search space used: 101970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory