Align ABC transporter for D-Cellobiose and D-Salicin, permease component 1 (characterized)
to candidate 3607838 Dshi_1246 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= reanno::Smeli:SMc04257 (305 letters) >FitnessBrowser__Dino:3607838 Length = 282 Score = 164 bits (414), Expect = 3e-45 Identities = 94/288 (32%), Positives = 160/288 (55%), Gaps = 12/288 (4%) Query: 20 KPRRTLSRRNIIVYGTLIVVALY-YLLPLYVMIVTSLKGMPEIRVGNIFAPPLEIT-FEP 77 +P R + Y +I +AL +LLPL + + S+K + GN + P E FE Sbjct: 4 RPIEKAPRAAQLTYQGMIPLALILWLLPLIAVAIFSVKPAGDFAAGNYWGWPAEFAGFEN 63 Query: 78 WVKAWAEACTGLNCDGLSRGFWNSVRITVPSVIISIAIASVNGYALANWRFKGADLFFTI 137 + + + ++ + R NS IT+P+VI ++A++ + G+AL +RF+G L F + Sbjct: 64 YARVFTDS-------EMPRYILNSFMITIPTVIGAVALSCMTGFALGIYRFRGNLLIFFM 116 Query: 138 LIVGAFIPYQVMIYPIVIVLREMGVYGTLTGLIIVHTIFGMPILTLLFRNYFAGLPEELF 197 I G F+P+Q+++ P+ + +MG+Y T TGL++ H F TL RN+ LP EL Sbjct: 117 FIAGNFVPFQILMVPVRDLTVDMGLYNTKTGLVLFHIAFQTGFCTLFMRNFIRALPYELI 176 Query: 198 KAARVDGAGFWTIYFKIMLPMSLPIFVVAMILQVTGIWNDFLFGVVFTR-PEYYPMTVQL 256 +AARV+G W I++ ++LP+ P +L T IWND+ + VV T+ P P+T + Sbjct: 177 EAARVEGVAEWRIFWFVVLPLMKPAIAALSVLIFTFIWNDYFWAVVLTQGPNAQPVTAGI 236 Query: 257 NNIVNSVQGVKEYNVNMAATILTGLVPLTVYFVSGRLFVRGIAAGAVK 304 + N+ G+ YN+ A +++ L P+ ++F+ + F+ G+ GAVK Sbjct: 237 TSF-NAQFGI-AYNMLSAGSLIAALPPVMMFFLMQKHFIAGLTLGAVK 282 Lambda K H 0.329 0.145 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 282 Length adjustment: 26 Effective length of query: 279 Effective length of database: 256 Effective search space: 71424 Effective search space used: 71424 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory