Align TM0029, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate 3609213 Dshi_2599 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= TCDB::Q9WXN6 (280 letters) >FitnessBrowser__Dino:3609213 Length = 267 Score = 102 bits (255), Expect = 7e-27 Identities = 75/247 (30%), Positives = 121/247 (48%), Gaps = 13/247 (5%) Query: 28 LGIFGPMFYRVDPTEMTWDYE-QPPSSAHPLGTDTYGRDVLAQLLHGIRSSLYIGFLAAI 86 L IFGPM DPT + +PP LGTD GRD+L++LLHG R SL + F+ ++ Sbjct: 17 LAIFGPMLAPHDPTAINIPNRLRPPGGEWLLGTDALGRDILSRLLHGARWSLGLAFVVSL 76 Query: 87 ISLVIGTIIGSFSAVKRGIVDDVLMGITNIVLTTPSILIAILIASYLKVRSVEMVAVILG 146 + L+IGT IG +A + D + M T+ L P ++ A++IA L + ++ L Sbjct: 77 LGLIIGTTIGLIAAQGGRVADWIAMRATDTFLAFPELIAAVVIAGVLGASTGSLI-FALT 135 Query: 147 LFQWPWFARAIRAQLMSVMSREYVYLSVMAGYSDLRLVIEDLIPTIATYAFMSFVLFING 206 + W +AR R +S+ +R YV + +AG S L + +P++ + + + Sbjct: 136 VTGWMRYARVARGIGLSISNRGYVVQAQLAGLSPLAIARWHYLPSLLPSLTVVWTGMLAR 195 Query: 207 GIMGEAGLSLIGLGPTQGISLGIMLQWAVLMEAVR---RGLWWWFVPPGLAIVAVTASLL 263 I+G + L +G G M +W ++ R R + PGL +V S+L Sbjct: 196 AILGISTLGFLGFGVQPP-----MPEWGTMLLDARIHMRSTPLQMIWPGLCVV---VSVL 247 Query: 264 VISTAMD 270 I+ A D Sbjct: 248 AINLAGD 254 Lambda K H 0.330 0.144 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 280 Length of database: 267 Length adjustment: 25 Effective length of query: 255 Effective length of database: 242 Effective search space: 61710 Effective search space used: 61710 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory