Align CbtD, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate 3607471 Dshi_0884 oligopeptide/dipeptide ABC transporter, ATPase subunit (RefSeq)
Query= TCDB::Q97VF5 (362 letters) >FitnessBrowser__Dino:3607471 Length = 360 Score = 190 bits (482), Expect = 6e-53 Identities = 108/299 (36%), Positives = 176/299 (58%), Gaps = 4/299 (1%) Query: 45 ILEVHNLNVIYDEGNSRIIKAVNDVSFGVEKGEILGIIGESGSGKTTLISAILRAIRPPG 104 +L + NL V + +++ V+ VS+ + GEILG++GESG+GK+ +A++ + PP Sbjct: 5 VLSIRNLTVDIPTRYA-VLRPVDKVSYDIAPGEILGVVGESGAGKSMAGNAVIGLLTPPA 63 Query: 105 KIISGKVIFNGMDIFSMTIDEFRKLLWKDISYVPQASQNALNPVLPISEIFYHEAISHGE 164 I SG+V NG I +T ++ R++ KDI V Q +LNP+L I + ++H Sbjct: 64 HISSGEVWLNGKRIDRLTPEQMRRVRGKDIGMVFQDPLTSLNPLLRIGDQLTETMLAHLP 123 Query: 165 ADKKRVIERASELLKLVGLDPARV-LKMYPFQLSGGMKQRVMIALSLLLNPKLILMDEPT 223 + ERA L+ VG+ AR + YP + SGGM+QRV+IAL+L P L++ DEPT Sbjct: 124 ISRAEAEERAVAALEEVGIPAARQRVNSYPHEFSGGMRQRVVIALALCAEPSLVIADEPT 183 Query: 224 SALDMLNQELLLKLIKNINQEMGVTIVYVTHDILNIAQIANRLLVMYKGYVMEEGKTEEI 283 +ALD+ Q ++ L+K + +E G ++ +THD+ IA+ A+R+ VMY G + E G E+ Sbjct: 184 TALDVSVQAQIIALLKRLCRERGTAVMLITHDMGVIAEAADRVAVMYAGRLAELGPVREV 243 Query: 284 IKSPLNPYTSLLVSSIP-SLKGEVKVINVPLDEPLVSK-EKGCPFLARCSKAFGRCKEE 340 + +P +PYT L+ S P + KG ++ +P P + + GC F RC +A +C+ + Sbjct: 244 LTAPRHPYTFGLMGSTPLASKGLKRLHQIPGSMPRLGRLPPGCAFSPRCPRAQDKCRHD 302 Lambda K H 0.319 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 360 Length adjustment: 29 Effective length of query: 333 Effective length of database: 331 Effective search space: 110223 Effective search space used: 110223 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory