Align CbtF, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate 3607472 Dshi_0885 oligopeptide/dipeptide ABC transporter, ATPase subunit (RefSeq)
Query= TCDB::Q97VF4 (324 letters) >FitnessBrowser__Dino:3607472 Length = 322 Score = 170 bits (430), Expect = 5e-47 Identities = 102/299 (34%), Positives = 169/299 (56%), Gaps = 23/299 (7%) Query: 27 ALKDVSLSMNQGDLLIVLGESGAGKTTLGRVIVGLQKPTSGEVVYDGYNIWKNKRKI-FK 85 A+ DVS + + + ++GESG+GK+T+G+++VGL +P+ G V G ++ + Sbjct: 35 AVSDVSFDVEERTVYALVGESGSGKSTIGKMVVGLLQPSEGSVKIGGTDLARETDPAKLD 94 Query: 86 KYRKDVQLIPQDPYSTLPFNKTVEEILVAPILRWEKINKDELRKRLINLLELVKLTPAEE 145 R D+Q+I QDP+++L V +I+ P+ +++ LLE V L A E Sbjct: 95 LVRADIQMIFQDPFASLNPRWRVRDIINEPV----SARGGDVKGLAERLLEQVGL--AAE 148 Query: 146 FLGKYPHQLSGGQKQRLSIARSLSVNPRIIVADEPVTMVDASLRIGILNTLAEIKNRLNL 205 GK+PH+ SGGQ+QR+ IAR+L+ P++IV DEP + +D S++ +LN ++++K+ L Sbjct: 149 DAGKFPHEFSGGQRQRICIARALASEPKLIVCDEPTSALDVSVQAQVLNLMSDLKDEFGL 208 Query: 206 TMVFITHDIPIARYFYHLFDKGNTIVMFAGRIVERADLEEILKDPLHPYTNDLIKLTPSI 265 T +FI+HD+ + + H+ D+ V++ GR+VE AD + + ++P HPYT L+ P + Sbjct: 209 TYLFISHDLTVVQ---HVADRIG--VLYLGRLVEEADPDTLFENPRHPYTQMLLAAAPKM 263 Query: 266 DNLYKEINV-------KINYERVEKGCPYRLRCPFAMDICKNEEPKLFKY-SHEVACFL 316 D +E+ IN GC + RCP A+ C E P+L VAC L Sbjct: 264 DGFGREVEPPKGEIPDPIN---PPTGCAFHPRCPIAVARCSAERPELRPLGGARVACHL 319 Lambda K H 0.321 0.141 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 295 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 322 Length adjustment: 28 Effective length of query: 296 Effective length of database: 294 Effective search space: 87024 Effective search space used: 87024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory