Align phosphogluconate dehydratase (EC 4.2.1.12) (characterized)
to candidate 3606698 Dshi_0129 dihydroxy-acid dehydratase (RefSeq)
Query= BRENDA::Q1PAG1 (608 letters) >FitnessBrowser__Dino:3606698 Length = 577 Score = 228 bits (580), Expect = 7e-64 Identities = 171/547 (31%), Positives = 265/547 (48%), Gaps = 40/547 (7%) Query: 32 SDGPQRGKLQCANFAHGVAGCGSEDKHSLRMMNAANVAIVSSYNDMLSAHQPYEHFPEQI 91 ++GP R + +A G+ E+ H V + + +N+ + + + Sbjct: 17 TEGPSRAPHRSYYYAMGMT---EEEIHQ------PLVGVATCWNEAAPCNIALSRQAQAV 67 Query: 92 KKALREM-GSVGQFAGGTPAMCDGVTQGEAGMELSLPSREVIALSTAVALSHNMFDAALM 150 K +++ G+ +F T + DG+ G GM SL SRE IA + + + + +DA + Sbjct: 68 KMGVKQASGTPREFT--TITVTDGIAMGHEGMRSSLASREAIADTVELTMRGHCYDAIVG 125 Query: 151 LGICDKIVPGLMMGALRFGHLPTIFVPGGPMPSGISNKEKADVRQ------RYAEGKATR 204 L CDK +PG+MM +R ++P++F+ GG + G N E V+ ++ G T Sbjct: 126 LAGCDKSLPGMMMAMVRL-NVPSVFIYGGSILPGRLNGEDVTVQDVFEAVGKHQAGNYTD 184 Query: 205 EELLESEMKSYHSPGTCTFYGTANTNQLLMEVMGLHLPGASFVNPYTPLRDALTHEAAQQ 264 EL E + S G C TANT + E +GL LP ++ RD + + Sbjct: 185 AELEVLERVACPSAGACGGQFTANTMACVSEAIGLALPNSAGAPAPYESRDQYGEASGRA 244 Query: 265 VTRLTKQSGNFTPIGEIVDERSLVNSIVALHATGGSTNHTLHMPAIAQAAGIQLTWQDMA 324 V L ++ +IV +SL N+ + TGGSTN LH+PAIA AGI+ T QD+ Sbjct: 245 VMDLIEKG---IRARDIVTRKSLENAARIVACTGGSTNAGLHLPAIAHEAGIEFTLQDVC 301 Query: 325 DLSEVVPTLSHVYPNGKADINHFQAAGGMAFLIRELLEAGLLHEDVNTVAGRGLSRYTQE 384 D+ P + P GK AGG+ ++REL AGL+HED TV G + + Sbjct: 302 DIFRDTPYFVDLKPGGKYVAKDMYEAGGVPVVMRELRRAGLIHEDCMTVTGYSIGEELDK 361 Query: 385 PFLDNGKLVWRDGPIESLDENILRPVARAFSPEGGLRVMEGNLG--RGVMKVSAVALQHQ 442 L+ D ++ PV S GG+ +EGNL ++K++ ++ Sbjct: 362 VTLE-------------ADGRVIYPVDTPLSTTGGVVGLEGNLAPEGAIVKIAGMSDDQL 408 Query: 443 IVEAPAVVFQDQQDLADAFKAGELEKDFVAVMRFQGPRSN-GMPELHKMTPFLGVLQDRG 501 + PA VF+ ++D +A + + V V+R +GP GM E+ T L Q G Sbjct: 409 VFTGPARVFECEEDAFEAVQNRAYAEGDVFVIRNEGPAGGPGMREMLATTAALSG-QGMG 467 Query: 502 FKVALVTDGRMSGASGKIPAAIHVSPEAQVGGALARVRDGDIIRVDGVKGTLELKVDADE 561 KVAL+TDGR SGA+ HV PEA GG +A ++DGD+I +D +KG L + + DE Sbjct: 468 KKVALITDGRFSGATRGFCVG-HVGPEAAHGGPIAMLKDGDMITIDALKGELSVALSEDE 526 Query: 562 FAAREPA 568 AAR+ A Sbjct: 527 LAARKDA 533 Lambda K H 0.318 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 948 Number of extensions: 59 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 608 Length of database: 577 Length adjustment: 37 Effective length of query: 571 Effective length of database: 540 Effective search space: 308340 Effective search space used: 308340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory