Align hexokinase (EC 2.7.1.1) (characterized)
to candidate 3608608 Dshi_2001 ROK family protein (RefSeq)
Query= BRENDA::Q5SLJ4 (302 letters) >FitnessBrowser__Dino:3608608 Length = 414 Score = 132 bits (332), Expect = 1e-35 Identities = 79/215 (36%), Positives = 119/215 (55%), Gaps = 14/215 (6%) Query: 39 VAEALAEAAERAEREAGVRGEAIGLGTPGPLDFRRGVIRFAPNIPGVQDFPIRRILEEAT 98 + E LA AA +R A A+G+G PG + G + ++P + G QD ++ I+E+ Sbjct: 145 IDEVLAAAALPRDRVA-----ALGVGLPGAVHHETGRVAWSPILAG-QDHALQAIIEDRF 198 Query: 99 GRPVFLENDANAAALAEHHLGAAQGEESSLYLTVSTGIGGGVVLGGRVLRGERGQGGELG 158 G P LENDAN LAE GA + + +T+ G+G G+VL R+ RG +G G ELG Sbjct: 199 GLPAHLENDANVLTLAELWFGAGRAMQDFAVVTIEQGVGMGLVLNNRLFRGAQGLGLELG 258 Query: 159 HLTLLPGGPACGCGLEGCLEALAAGRALERDATYAFQRPVDTRE--------LFRLFQAG 210 H + G C CG GCLEA A AL R+A+ A R + + LF +AG Sbjct: 259 HTKVQLDGALCRCGQRGCLEAYLADYALVREASTALDRDPRSAQTAAAMLESLFDQAKAG 318 Query: 211 DPKAERLVLQAARYVGIGLASLVKAFDPGVVVLGG 245 + A+ + +A R++ +GLA++V+ FDP +++L G Sbjct: 319 NGAAKAIFQRAGRFLSLGLANVVQLFDPELIILSG 353 Lambda K H 0.318 0.141 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 414 Length adjustment: 29 Effective length of query: 273 Effective length of database: 385 Effective search space: 105105 Effective search space used: 105105 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory