Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate 3609257 Dshi_2643 D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding (RefSeq)
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >FitnessBrowser__Dino:3609257 Length = 316 Score = 194 bits (493), Expect = 2e-54 Identities = 123/320 (38%), Positives = 176/320 (55%), Gaps = 13/320 (4%) Query: 3 KIVAWKSLPEDVLAYLQQHAQVVQVDATQH---DAFVAALKDADG-----GIGSSVKITP 54 K++ + LPE VLA + + TQ + AL+D D G S ++ Sbjct: 2 KLLISRPLPEAVLARARARFDCTLRETTQPMRAEELRGALRDYDLVLPTLGDAFSAEVFA 61 Query: 55 AMLEGATRLKALSTISVGFDQFDVADLTRRGIVLANTPDVLTESTADTVFSLILASARRV 114 + E RL L+ VG++ D G+ + NTP +T++TADT +LIL +ARR Sbjct: 62 DVPEPRARL--LANFGVGYNHIDAVAARAAGVAVTNTPGAVTDATADTALTLILMAARRA 119 Query: 115 VELAEWVKAGHWQHSIGPALFGVDVQGKTLGIVGLGRIGGAVARRAALGFNMKVLYTNRS 174 E V+AG W + G+ V GKTLG++G+GRIG A+A R GF M+V++ NRS Sbjct: 120 GEGERLVRAGTWTGWHPTQMLGLHVTGKTLGVIGMGRIGQAIAARCHHGFGMEVVFYNRS 179 Query: 175 ANPQAEEAYGARRVELAELLATADFVCLQVPLTPETKHLIGAAELKSMKKSAILINASRG 234 P+ + + +AE++A AD V + VP ET HLIGA +M+ A+ +N +RG Sbjct: 180 --PKTPDLPARQLASVAEVMAAADIVVVAVPGGAETHHLIGAEAFAAMQPHAVFVNIARG 237 Query: 235 ATVDEKALIEALQNGTIHGAGLDVFETEPLPSDSPLLKLANVVALPHIGSATHETRHAMA 294 VDE ALI ALQ G + AGLDV+E EP ++ L+ + NVV LPH+G+A E R AM Sbjct: 238 DVVDEAALIAALQAGQLGAAGLDVYEFEPAVPEA-LIGMENVVLLPHLGTAALEVREAMG 296 Query: 295 RNAAENLVAALDGTLTSNIV 314 A +NL+A +G N V Sbjct: 297 HMALDNLIACAEGAPLPNPV 316 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 316 Length adjustment: 27 Effective length of query: 294 Effective length of database: 289 Effective search space: 84966 Effective search space used: 84966 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory