Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate 3607127 Dshi_0549 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= uniprot:A3DE71 (289 letters) >FitnessBrowser__Dino:3607127 Length = 272 Score = 140 bits (352), Expect = 4e-38 Identities = 82/267 (30%), Positives = 140/267 (52%), Gaps = 9/267 (3%) Query: 24 ILAILVVLTLGPIVFMVLTSLMDHNAIARGK--WIAPTRFSNYVEVFQKLPFGIYFRNSL 81 +L +++ + + P +MV TSL WI SNY E + NSL Sbjct: 13 LLVLIITVCVFPFYWMVTTSLKTQIVALEAPPVWIFEPTLSNYREALFEDGVLRTLINSL 72 Query: 82 IVCSIVMVVALVIATLAGYSLAKYKFPGSGFFGILILATQLLPGMMFLLPLYLDFVKIKQ 141 I+ +ALV+ A ++LA+++F G + +++ ++ LP +L Sbjct: 73 IIAISTTFLALVLGVPAAFALARFEFRGKKDLWFWFITNRMISPIVLALPFFLI------ 126 Query: 142 ATGIQLINSIPGLVIVYSAFFVPFSIWIIRGFFASIPGELEEAARIDGCNKFTAFLRVML 201 A + L++ L+++Y F +P IWI+ F IP +L+EAAR++G ++FT ++ L Sbjct: 127 ARNLGLLDKHITLILIYLTFNLPIVIWIVTDQFRGIPYDLDEAARLEGASQFTIMRKICL 186 Query: 202 PLAVPGIVATAIYIFLTAWDELIFAWVLLKDTKVTTIPAGIRGFIAYTTARYDLLMAAGT 261 PLA+PG+ +AI+ F+ +W+EL+F +L + ++ T PA F+ Y +MA T Sbjct: 187 PLAMPGVAVSAIFSFIFSWNELMFGLILTR-SEAKTAPAMAVSFMEGYNLPYGKIMATST 245 Query: 262 IVTIPVLIMFFTMQKKFISGMTAGAVK 288 ++ IPVLI K+ + G+T GAVK Sbjct: 246 LIVIPVLIFALIASKQLVRGLTMGAVK 272 Lambda K H 0.332 0.145 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 272 Length adjustment: 26 Effective length of query: 263 Effective length of database: 246 Effective search space: 64698 Effective search space used: 64698 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory