Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate 3608246 Dshi_1650 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= uniprot:A3DHA2 (303 letters) >FitnessBrowser__Dino:3608246 Length = 385 Score = 95.9 bits (237), Expect = 1e-24 Identities = 71/210 (33%), Positives = 108/210 (51%), Gaps = 11/210 (5%) Query: 103 FLNSAIMTIPIVIIQVIVGVFAAYAFAKLRFPLRDKLFFVFIVVMLMPLQVTLVPNYILL 162 F N+ +TIP II ++V FAAYA A + FP R L + + ++++PLQ+ L+P L Sbjct: 178 FFNTLTVTIPATIIPILVAAFAAYALAWMEFPGRALLIALIVGLLVVPLQLALIPLLTLH 237 Query: 163 RKLDMIGSFLSVILPG-GFSA-FGVVLLRQYMRGIPDECCEAAMIDGAGYLKTFTKIILP 220 + + +L L GF + LLR YM G+P + E A +DGA + FTKI+LP Sbjct: 238 NAIGIGKGYLGTWLAHTGFGMPLAIYLLRNYMVGLPRDIIENAKVDGATDFQIFTKIVLP 297 Query: 221 QCKSIIASLAILAFIDNWNMVEQPLIFLSDSAKYPLSVYLAYINE--GDLG-----LAFA 273 +AS AI F+ WN + +FL D A +V I E G G LA A Sbjct: 298 LSFPALASFAIFQFLWTWNDLLVAKVFLID-ATGQTTVMTNQIVELLGTRGGNWEILATA 356 Query: 274 SGVLYMIPTVLIYLYGEKYFVEGIQLTGIK 303 + V +P +L++ +++ V G+ +K Sbjct: 357 AFVSIAVP-LLVFFSMQRFLVRGLLAGSVK 385 Lambda K H 0.331 0.147 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 385 Length adjustment: 29 Effective length of query: 274 Effective length of database: 356 Effective search space: 97544 Effective search space used: 97544 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory