Align Fe(3+) dicitrate transport system permease protein FecC; Iron(III) dicitrate transport system permease protein FecC (characterized)
to candidate 3607150 Dshi_0572 transport system permease protein (RefSeq)
Query= SwissProt::P15030 (332 letters) >FitnessBrowser__Dino:3607150 Length = 360 Score = 170 bits (430), Expect = 6e-47 Identities = 112/327 (34%), Positives = 177/327 (54%), Gaps = 18/327 (5%) Query: 23 WLSLFCYSA----IPVSGADATRALLPG-HTPTLP---EALVQNLRLPRSLVAVLIGASL 74 W+ L SA I +GA A+ T TL + ++ ++RLPR + +L+GA+L Sbjct: 31 WIFLLAVSAFSLGIGAAGAQVRAAVADWIRTGTLDAGAQVILFDIRLPRLALGLLVGAAL 90 Query: 75 ALAGTLLQTLTHNPMASPSLLGINSGAALAMALTSALSPT-------PIAGYSLSFIAAC 127 A+AG ++Q L NP+A P ++G+++GA L L L + Y + A Sbjct: 91 AVAGAVMQGLFRNPLADPGIVGVSAGAGLGAILAIVLGAALPAFFIDALGNYLIPLAAFA 150 Query: 128 GGGVSWLLVMTAGGGFRHTHDRNKLILAGIALSAFCMGLTRITLLLAEDHAY-GIFYWLA 186 GG S +L+ T ++LAGIAL+A L+ I + +A+D + +W Sbjct: 151 GGWGSTILLYKVSTRRGRTSVAT-MLLAGIALAALTGALSGILVYIADDRQLRDLTFWGL 209 Query: 187 GGVSHARWQDVWQLLPVVVTAVPVVLLLANQLNLLNLSDSTAHTLGVNLTRLRLVINMLV 246 G ++ A W V P++ A LLA LN + L ++ A +GV L RL+ ++V Sbjct: 210 GSLAGATWTKVLIAGPLIAVAFLSAPLLARGLNGMALGEAAAAHMGVALERLKTGAILIV 269 Query: 247 LLLVGACVSVAGPVAFIGLLVPHLARFWAGFDQRNVLPVSMLLGATLMLLADVLARALAF 306 GA V+V+G + F+G++VPHL R G D R +LP + LLGA+L++LAD ++R + Sbjct: 270 ASATGAAVAVSGGIGFVGIVVPHLLRIAVGPDHRTLLPNAALLGASLLVLADCISRTIIA 329 Query: 307 PGDLPAGAVLALIGSPCFVW-LVRRRG 332 P +LP G V A++G+P F+W L+R RG Sbjct: 330 PAELPIGIVTAVLGAPVFLWILLRARG 356 Lambda K H 0.327 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 331 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 360 Length adjustment: 29 Effective length of query: 303 Effective length of database: 331 Effective search space: 100293 Effective search space used: 100293 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory