Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate 3606891 Dshi_0321 ABC transporter related (RefSeq)
Query= reanno::pseudo1_N1B4:Pf1N1B4_3435 (254 letters) >FitnessBrowser__Dino:3606891 Length = 258 Score = 234 bits (597), Expect = 1e-66 Identities = 119/247 (48%), Positives = 161/247 (65%), Gaps = 11/247 (4%) Query: 4 LEVQDLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLN 63 +E+ ++K YG VL+ ++L G+ I I G SGSGKST +RCIN LE+ AG I + Sbjct: 18 IEIDKMNKWYGQFHVLRDINLTVYRGERIVICGPSGSGKSTLIRCINALEEHQAGSITV- 76 Query: 64 NEELKLVANKDGALKAADPKQLQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGMSK 123 DG L ++D K + +RS + M FQHFNL+ H+T +EN AP+ V K Sbjct: 77 ----------DGTLLSSDLKNIDTIRSEVGMCFQHFNLFPHLTILENCTLAPIWVRKTPK 126 Query: 124 TEAREKAEHYLNKVGVAHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDPE 183 EA A H+L KV + + + YPG +SGG+QQRVAIAR+L M P +MLFDEPTSALDPE Sbjct: 127 KEAEATAMHFLEKVKIPDQANKYPGQLSGGQQQRVAIARSLCMRPRIMLFDEPTSALDPE 186 Query: 184 LVGDVLKVMQALAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVNPQSE 243 ++ +VL M LA+EG TM+ VTHEMGFAR+V+N+++F+ G + E P E NPQS+ Sbjct: 187 MIKEVLDTMIELAEEGMTMICVTHEMGFARQVANRVIFMDAGQIVEQNEPEEFFGNPQSD 246 Query: 244 RLQQFLS 250 R + FLS Sbjct: 247 RTKLFLS 253 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 258 Length adjustment: 24 Effective length of query: 230 Effective length of database: 234 Effective search space: 53820 Effective search space used: 53820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory