Align ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)
to candidate 3608656 Dshi_2049 ABC transporter related (RefSeq)
Query= uniprot:A0A1N7U8S3 (276 letters) >FitnessBrowser__Dino:3608656 Length = 259 Score = 132 bits (333), Expect = 6e-36 Identities = 79/235 (33%), Positives = 134/235 (57%), Gaps = 12/235 (5%) Query: 17 VAQPVTAAIKLQVEGIHKRYGEHEVLKGVSLNARQGDVISLIGASGSGKSTMLRCINFLE 76 +A+PV I+ V G+ ++G H V + + L+ R+G+++ ++G SG+GKS +LR I L Sbjct: 1 MAEPVENVIR--VRGVRTQFGTHVVHEDLDLDVRRGEILGVVGGSGTGKSVLLRTIAGLL 58 Query: 77 QPDAGVITLDGISIEMRQGRAGTRAPHQDQLQNLRTRLAMVFQHFNLWSHMTVLENITMA 136 +P AG + + G +M TRA + R ++FQ L+S +TV EN+ + Sbjct: 59 RPAAGRVEVLGT--DMLSADEATRAA-------VEARWGVMFQDGALFSSLTVRENVEVP 109 Query: 137 PRRVLDVSAAEAEKRARMYLDKVGLPSRVADQYPAFLSGGQQQRVAIARALAMEPEIILF 196 R + + AA A + + VGLP D+YP+ LSGG ++R +ARALA++PEI+ Sbjct: 110 MRAIPGLDAATRRALAALKVSMVGLPPVAEDKYPSELSGGMRKRAGLARALALDPEIVFL 169 Query: 197 DEPTSALDPELVGEVLKVIQTLAEE-GRTMLMVTHEMGFARQVSSQVLFLHQGRV 250 DEPT+ LDP + +I+ L+ + G T+ +VTH++ + ++ L + +V Sbjct: 170 DEPTAGLDPIGAADFDTLIKGLSTDLGLTVFLVTHDLDTLHAICDRIAVLAERKV 224 Lambda K H 0.319 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 259 Length adjustment: 25 Effective length of query: 251 Effective length of database: 234 Effective search space: 58734 Effective search space used: 58734 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory