Align Ornithine cyclodeaminase; OCD; EC 4.3.1.12 (characterized)
to candidate 3608919 Dshi_2310 Ornithine cyclodeaminase (RefSeq)
Query= SwissProt::P09773 (354 letters) >FitnessBrowser__Dino:3608919 Length = 357 Score = 473 bits (1218), Expect = e-138 Identities = 230/345 (66%), Positives = 280/345 (81%) Query: 1 MPALANLNIVPFISVENMMDLAVSTGIENFLVQLAGYIEEDFRRWESFDKIPRIASHSRD 60 +P ++L + F+SVENMM L S GIE L LA YIE+DFRRWE FDK PR+ASHS + Sbjct: 9 VPGPSDLAYIRFVSVENMMKLVHSIGIETMLRDLARYIEDDFRRWEKFDKTPRVASHSPE 68 Query: 61 GVIELMPTSDGTLYGFKYVNGHPKNTKSGRQTVTAFGVLSDVDSGYPLLLSEMTILTALR 120 GVIELMPTSDG YGFKYVNGHP+NTK G QTVTAFG+L+ VD+GYP LL+EMT+LTALR Sbjct: 69 GVIELMPTSDGEDYGFKYVNGHPRNTKDGLQTVTAFGLLARVDTGYPELLTEMTVLTALR 128 Query: 121 TAATSAIAAKYLARKDSRTMALIGNGAQSEFQALAFKALIGVDRIRLYDIDPEATARCSR 180 TAATSA+ A +LA K SR MA+IGNGAQSEFQALA +A+ G+D +RLYDID AT + R Sbjct: 129 TAATSAMVASHLAPKGSRVMAMIGNGAQSEFQALAMRAICGIDTLRLYDIDRAATEKVRR 188 Query: 181 NLQRFGFQIEACTSAEQAVEGADIITTATADKHNATILSDNMIGPGVHINGVGGDCPGKT 240 NL GF++ C + E+A+EGA IITT TADK ATIL+DNM+G G+HIN +GGDCPGKT Sbjct: 189 NLTGQGFELIPCATPEEAIEGAQIITTCTADKQFATILTDNMVGAGLHINAIGGDCPGKT 248 Query: 241 EMHRDILLRSDIFVEFPPQTRIEGEIQQLAPDHPVTELWRVMTGQDVGRKSDKQITLFDS 300 E+H+DIL+RSD+FVE+PPQTRIEGEIQQ+ D PVTE+W+V+TG GR +D+QITLFD Sbjct: 249 ELHKDILIRSDVFVEYPPQTRIEGEIQQMPEDFPVTEMWQVITGAAPGRINDRQITLFDG 308 Query: 301 VGFAIEDFSALRYVRDRVEGSSHSSPLDLLADPDEPRDLFGMLLR 345 VGFAIEDFSALRY+RD+++ LD++ADPD+PRDLFGM+ R Sbjct: 309 VGFAIEDFSALRYLRDKLKDHPFYEDLDIIADPDDPRDLFGMIQR 353 Lambda K H 0.320 0.137 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 427 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 357 Length adjustment: 29 Effective length of query: 325 Effective length of database: 328 Effective search space: 106600 Effective search space used: 106600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory