Align Ornithine aminotransferase; Orn-AT; Lysine aminotransferase; Lys-AT; EC 2.6.1.13; EC 2.6.1.36 (characterized)
to candidate 3608649 Dshi_2042 aminotransferase class-III (RefSeq)
Query= SwissProt::Q5JEW1 (445 letters) >FitnessBrowser__Dino:3608649 Length = 460 Score = 199 bits (505), Expect = 2e-55 Identities = 137/430 (31%), Positives = 217/430 (50%), Gaps = 37/430 (8%) Query: 37 PIVIERGEGIRVYDVDGNVFYDFASG-VGVINVGHSHPRVVEAIKKQAEKFTHYSLTDFF 95 P +I G+G+RV+D G D SG + +NVG+ R+ A++ Q + +S + Sbjct: 36 PRIIVEGKGMRVWDALGKEHLDAVSGGLWTVNVGYGRERIANAVRDQLMQMCFFSNSLGT 95 Query: 96 YENAIILAEKLIELAPGDIERKVVYGNSGAEANEAAMKLVK------YGTGRKQFLAFYH 149 AI +E LI+ PG +V Y +SG+EANE A K+V+ +G + + L Sbjct: 96 IPGAIF-SEMLIDKMPG--MSRVYYASSGSEANEKAFKMVRQIAHKVHGGRKTKILYRER 152 Query: 150 AFHGRTQAVLSLTASKWVQQDGFFPTMPGVTHIPYPNPYRNTWGIDGYEEPDELTNRVLD 209 +HG T A +S +W ++ + P P +P+ YR W + Y E R D Sbjct: 153 DYHGSTLATMS-AGGQWERKAQYGPFAPDFVEVPHCLEYRAQWEGENYGE------RAAD 205 Query: 210 FIEEYVFRHVPPHEIGAIFFEPIQGEGGYVVPPKGFFKALKKFADEYGILLADDEVQMGI 269 IEE + R P +GA+ EP+ GG + PP+G++ +++ +Y +LL DEV G+ Sbjct: 206 AIEEVILRE-GPDTVGALCLEPVTAGGGVITPPEGYWPRVQEICRKYDVLLHIDEVVCGL 264 Query: 270 GRTGKFWAIEHFGVEPDLIQFGKAIGGGLPLAGVIHRADITFD----KPG------RHAT 319 GRTGK++ +H+G+EPD + K + G + + F+ +PG R + Sbjct: 265 GRTGKWFGYQHYGIEPDFVTMAKGVASGYAAISCMVTTERVFEMFKSEPGAPLDYFRDIS 324 Query: 320 TFGGNPVAIAAGIEVVEIVKE--LLPHVQEVGDYLHKYLEEFKEKYEVIGDARGLGLAQA 377 TFGG AA IE ++I++E LL + + D L L EK+ VIGD RG GL Sbjct: 325 TFGGCTAGPAAAIENMKIIEEEDLLGNTDRMHDQLMGNLAGLMEKHRVIGDIRGKGLFCG 384 Query: 378 VEIVKSKETKEKYPE-LRDRIVKESAKRGLVL------LGCGDNSIRFIPPLIVTKEEID 430 E+V + TKE PE L +V + +G+++ L +N++ F P LI T ++ID Sbjct: 385 AELVADRTTKEPAPEALVQAVVADCMAQGVIIGATNRSLPGYNNTLCFSPALIATADDID 444 Query: 431 VAMEIFEEAL 440 + + AL Sbjct: 445 QITDAVDGAL 454 Lambda K H 0.320 0.141 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 526 Number of extensions: 26 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 460 Length adjustment: 33 Effective length of query: 412 Effective length of database: 427 Effective search space: 175924 Effective search space used: 175924 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory