Align deoxynucleoside transporter, permease component 2 (characterized)
to candidate 3607107 Dshi_0529 Monosaccharide-transporting ATPase (RefSeq)
Query= reanno::Burk376:H281DRAFT_01112 (364 letters) >FitnessBrowser__Dino:3607107 Length = 333 Score = 275 bits (703), Expect = 1e-78 Identities = 140/314 (44%), Positives = 202/314 (64%) Query: 51 EWFTVALIVVTCLIVGAINPRFFQFATLFDLLHSATTMSLFALGTLVVLASGGIDVSFTA 110 E +I++ C + +PRF T+ DLL ++ + + A+G ++VL SGGIDVSFTA Sbjct: 14 ETLVAGVIMLFCFVATVSDPRFLTITTVSDLLRASIVIGILAVGAMLVLVSGGIDVSFTA 73 Query: 111 IAALTMYGITKAVFAWWPDAPFALILVTGALGGVVLGMVNGLLVHRLKAPSLIVTIGTQY 170 IA MY T WP+ P+ +I V + G LG +NG + L P+LIVT+GT Sbjct: 74 IAVFAMYSSTVLSLTIWPEIPWPVIFVISVVFGAALGAINGFFIAFLGLPTLIVTLGTLS 133 Query: 171 LYRGLLLTFIGTTFFMNIPHSMDRFGRIPLFFYHTADGLRAVLPVSVLALVAAAVVTWWL 230 ++RG LLTFIG+ ++P SM F R + T G +P + LAL+ V+TW++ Sbjct: 134 IFRGFLLTFIGSQRISDLPPSMRDFSRGVIARGTTEAGNFYSIPWAALALLFVIVLTWFI 193 Query: 231 LNRTMMGRAVYAMGGSLAIAERLGYNLRAIHLFVFGYTGMLAGIAGILHVSNNRLANPFD 290 L +TM+GR++YA+GGS+ A R+G N++ FV+ Y G LAG+AGI+H S R+A+PF Sbjct: 194 LKKTMLGRSIYAIGGSVESARRIGINVKWTQFFVYVYVGALAGLAGIIHGSVGRMADPFS 253 Query: 291 LVGSELDVIAAVILGGARITGGTGTVVGTLLGVVLVTLIKSVLILVGVPSTWQKVIIGAF 350 LVG EL VIAAV+LGGAR+ GG GT+ GT+LGV L+ ++++ LI++G+P+TWQ V IG Sbjct: 254 LVGLELSVIAAVVLGGARLIGGYGTLTGTMLGVALIVIVQNSLIVIGIPTTWQSVTIGIL 313 Query: 351 ILLAGTLFALQRKR 364 ILL + A + KR Sbjct: 314 ILLGTGVPAYRAKR 327 Lambda K H 0.328 0.141 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 339 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 333 Length adjustment: 29 Effective length of query: 335 Effective length of database: 304 Effective search space: 101840 Effective search space used: 101840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory