Align Purine/cytidine ABC transporter ATP-binding protein, component of General nucleoside uptake porter, NupABC/BmpA (transports all common nucleosides as well as 5-fluorocytidine, inosine, deoxyuridine and xanthosine) (Martinussen et al., 2010) (Most similar to 3.A.1.2.12). NupA is 506aas with two ABC (C) domains. NupB has 8 predicted TMSs, NupC has 9 or 10 predicted TMSs in a 4 + 1 (or 2) + 4 arrangement (characterized)
to candidate 3608553 Dshi_1947 ABC transporter related (RefSeq)
Query= TCDB::A2RKA7 (506 letters) >lcl|FitnessBrowser__Dino:3608553 Dshi_1947 ABC transporter related (RefSeq) Length = 514 Score = 380 bits (975), Expect = e-110 Identities = 205/502 (40%), Positives = 302/502 (60%), Gaps = 3/502 (0%) Query: 6 VIQMIDVTKRFGDFVANDKVNLELKKGEIHALLGENGAGKSTLMNILSGLLEPSEGEVHV 65 V+++ +TKRFG AND ++ +L GE+ ALLGENGAGK+TLMNIL G EG V V Sbjct: 10 VLRLDQITKRFGALTANDAISFDLHAGEVVALLGENGAGKTTLMNILFGHYTADEGTVEV 69 Query: 66 KGKLENIDSPSKAANLGIGMVHQHFMLVDAFTVTENIILGNEVTKGINLDLKTAKKKILE 125 G+ P A G+GMVHQHF L D +V +N+ILG L A++K+ Sbjct: 70 FGQTLPPGVPRAALAAGVGMVHQHFTLADNLSVLDNVILGTVPLWRAGLGSGAARRKLRA 129 Query: 126 LSERYGLSVEPDALIRDISVGQQQRVEILKTLYRGADILIFDEPTAVLTPAEITELMQIM 185 L+E +GL V+P+A + +SVG++QRVEILK LYR A ILI DEPTAVLTP E L + Sbjct: 130 LAEDFGLQVDPEARVGTLSVGERQRVEILKALYRDARILILDEPTAVLTPQEAEALFATL 189 Query: 186 KNLIKEGKSIILITHKLDEIRAVADRITVIRRGKSIDTVELGDKTNQELAELMVGRSVSF 245 + + G S+I I+HKL E+ +VA R+ V+R G+ + V + LAE+MVG ++ Sbjct: 190 RRAVARGMSVIFISHKLHEVMSVAHRVVVLRHGRVVGRVATDETDRHALAEMMVGAEITA 249 Query: 246 ITEKAAAQPKDVVLEIKDLNIKESRGSLK-VKGLSLDVRAGEIVGVAGIDGNGQTELVKA 304 + A L D ++RG+ ++ +SL +RAG+I G+AG+ GNGQ L Sbjct: 250 PAPRPAT--PGAALMTLDRVCTDARGTATGLRDVSLTLRAGQITGLAGVSGNGQAALADL 307 Query: 305 ITGLTKVDSGSIKLHNKDITNQRPRKITEQSVGHVPEDRHRDGLVLEMTVAENIALQTYY 364 I GL +G+++L N ++ + PR Q +G +PEDRH+ G + + T+ EN L+ Y Sbjct: 308 IGGLIAPVAGALRLGNAEVADWSPRAALAQGIGRIPEDRHKTGTIADFTLTENAILEAYP 367 Query: 365 KPPMSKYGFLDYNKINSHARELMEEFDVRGAGEWVSASSLSGGNQQKAIIAREIDRNPDL 424 K S+ G++ + S AR+++ +DVR G LSGGN QK I+ R ++ P + Sbjct: 368 KAQFSRSGWMRWGAAESFARDVIASYDVRCPGPETPIRLLSGGNMQKLILGRVLEDGPRI 427 Query: 425 LIVSQPTRGLDVGAIEYIHKRLIQARDEGKAVLVISFELDEILNVSDRIAVIHDGQIQGI 484 ++ +QP RGLD+GA+ Y+ ++LI ARD G AVL+IS +LDE+L +SD I V+ +G++ Sbjct: 428 VLANQPVRGLDIGAVTYVQEQLIAARDGGAAVLLISEDLDEVLALSDVIHVMSEGRLSPE 487 Query: 485 VSPETTTKQELGILMVGGNINE 506 + + T +LG+ M G E Sbjct: 488 FARGSMTPAQLGVWMAGDGFAE 509 Lambda K H 0.315 0.135 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 596 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 506 Length of database: 514 Length adjustment: 34 Effective length of query: 472 Effective length of database: 480 Effective search space: 226560 Effective search space used: 226560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory