GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pta in Dinoroseobacter shibae DFL-12

Align phosphate acetyltransferase (EC 2.3.1.8) (characterized)
to candidate 3608428 Dshi_1825 phosphate acetyltransferase (RefSeq)

Query= BRENDA::Q5LMK3
         (337 letters)



>lcl|FitnessBrowser__Dino:3608428 Dshi_1825 phosphate
           acetyltransferase (RefSeq)
          Length = 341

 Score =  333 bits (855), Expect = 3e-96
 Identities = 183/327 (55%), Positives = 223/327 (68%), Gaps = 1/327 (0%)

Query: 6   PIDLLLSDPPARRATVALSEGSDPRVVAGALAAHSAGIADVILVGQAAEIRAAL-KAQGA 64
           P+ ++L++       +ALSEG DPRVVA A+ A    +A V+LVG  A I A L +A GA
Sbjct: 3   PLQMILANAARSDRKIALSEGEDPRVVAAAVQARKQRVARVVLVGDRATIVARLAEAGGA 62

Query: 65  PADSLTIHDPDSSPLTAEFAAAYYGLRRHKGVSEAAALAAVRTPLVYAAMLVRGDHAVGT 124
             D + +HDP      AE AA Y+ LR+HKGV+EA A AA+  P VYAA+LVR  HA GT
Sbjct: 63  ELDGIDVHDPREDLHRAEMAATYHQLRKHKGVTEADAEAAILNPHVYAALLVRLGHADGT 122

Query: 125 VGGAVATTSDVVRTAIQVIGAAPGAAMVSSFFLMYPPEAATAHARAMLYSDSGLVIDPSV 184
           +GGA ATT+++VRTAIQVIG APGA MVSSFFLM   +        ++++D+GLVIDP+ 
Sbjct: 123 LGGATATTAEIVRTAIQVIGTAPGAKMVSSFFLMLLCKDHHEKKGGLVFADAGLVIDPTA 182

Query: 185 AELAAIAAASAASCRALLRAEPKIAMLSFSTKGSARHPHVSKVTDALARLRADHPDLDAD 244
           AE+A I  ASAAS   L    P++AMLSFST+GSA    VSKV +A    R   P++  D
Sbjct: 183 AEMAEIGRASAASLVQLTGETPRVAMLSFSTRGSASGDKVSKVVEATEIFRQLAPEVTVD 242

Query: 245 GELQFDAAFVPSVGASKAPGSDVAGQANVMIFPNLDAGNIGYKITQRLGGYTAIGPVLQG 304
           GELQFDAAFVP V  +KAP S + G ANV +FPNLD GNI YKI QR+GG  AIGP+LQG
Sbjct: 243 GELQFDAAFVPEVATAKAPDSAIGGSANVFVFPNLDTGNIAYKIAQRIGGAVAIGPILQG 302

Query: 305 LAKPANDLSRGCVAGDVTQMIAVTVLQ 331
           LA PANDLSRGC A DV  MIA T  Q
Sbjct: 303 LALPANDLSRGCSAEDVLHMIATTAAQ 329


Lambda     K      H
   0.317    0.130    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 268
Number of extensions: 12
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 337
Length of database: 341
Length adjustment: 28
Effective length of query: 309
Effective length of database: 313
Effective search space:    96717
Effective search space used:    96717
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)

Align candidate 3608428 Dshi_1825 (phosphate acetyltransferase (RefSeq))
to HMM TIGR00651 (pta: phosphate acetyltransferase (EC 2.3.1.8))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00651.hmm
# target sequence database:        /tmp/gapView.24135.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00651  [M=304]
Accession:   TIGR00651
Description: pta: phosphate acetyltransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
   6.5e-106  340.2   0.1   7.4e-106  340.0   0.1    1.0  1  lcl|FitnessBrowser__Dino:3608428  Dshi_1825 phosphate acetyltransf


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Dino:3608428  Dshi_1825 phosphate acetyltransferase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  340.0   0.1  7.4e-106  7.4e-106       1     304 []      18     327 ..      18     327 .. 0.98

  Alignments for each domain:
  == domain 1  score: 340.0 bits;  conditional E-value: 7.4e-106
                         TIGR00651   1 ivlPEgseervlkAaallaekkiaekvllvnkeeevknkakevnlklgkvvvedpdvskdiekyverlyekrkhkGv 77 
                                       i l Eg+++rv+ Aa +  ++++a+ vl+++ +++v+  a+    +l  + v+dp+   ++ + + +++++rkhkGv
  lcl|FitnessBrowser__Dino:3608428  18 IALSEGEDPRVVAAAVQARKQRVARVVLVGDRATIVARLAEAGGAELDGIDVHDPREDLHRAEMAATYHQLRKHKGV 94 
                                       6689************************999999999999999********************************** PP

                         TIGR00651  78 tekeareqlrDevslaallvelgeadglvsGavsttaktlrpalqiiktlegvklvssvfimekee......evlvf 148
                                       te+ a+ ++ ++ ++aallv+lg+adg+  Ga  tta+++r+a+q+i+t++g k+vss+f+m + +      + lvf
  lcl|FitnessBrowser__Dino:3608428  95 TEADAEAAILNPHVYAALLVRLGHADGTLGGATATTAEIVRTAIQVIGTAPGAKMVSSFFLMLLCKdhhekkGGLVF 171
                                       **************************************************************987777888899*** PP

                         TIGR00651 149 aDCavavdPnaeeLAeiAlqsaksakslgeeepkvallsystkgsgkgeevekvkeAvkilkekepdllldGelqfD 225
                                       aD  +++dP+a e+Aei   sa+s  +l++e p+va+ls+st+gs++g++v kv+eA++i+++ +p++++dGelqfD
  lcl|FitnessBrowser__Dino:3608428 172 ADAGLVIDPTAAEMAEIGRASAASLVQLTGETPRVAMLSFSTRGSASGDKVSKVVEATEIFRQLAPEVTVDGELQFD 248
                                       ***************************************************************************** PP

                         TIGR00651 226 aAlvekvaekkapesevagkanvfvFPdLdaGnigYkivqRladaeaiGPilqGlakPvnDLsRGasvedivnvvii 302
                                       aA+v++va+ kap+s++ g+anvfvFP+Ld+Gni+Yki+qR+++a aiGPilqGla P nDLsRG+s+ed++++++ 
  lcl|FitnessBrowser__Dino:3608428 249 AAFVPEVATAKAPDSAIGGSANVFVFPNLDTGNIAYKIAQRIGGAVAIGPILQGLALPANDLSRGCSAEDVLHMIAT 325
                                       *************************************************************************9998 PP

                         TIGR00651 303 ta 304
                                       ta
  lcl|FitnessBrowser__Dino:3608428 326 TA 327
                                       75 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (304 nodes)
Target sequences:                          1  (341 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 12.93
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory