Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate 3609507 Dshi_2891 short-chain dehydrogenase/reductase SDR (RefSeq)
Query= metacyc::MONOMER-20835 (262 letters) >FitnessBrowser__Dino:3609507 Length = 242 Score = 121 bits (304), Expect = 1e-32 Identities = 84/246 (34%), Positives = 124/246 (50%), Gaps = 12/246 (4%) Query: 12 GLRVLISGGAAGIGEVLAAAYLEAGAQVHVCDVSESALAVFRDKYPGTVATRADVSDAAQ 71 G +++GG +G G + + GAQV V D+++ A ++Y GT A + DVSDA Sbjct: 5 GKTAIVTGGGSGFGAGIVRKFAAEGAQVIVADINKGAAEAVAEEYGGTAA-QVDVSDADS 63 Query: 72 IEAVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTAQYRFAHHAVPM 131 + A+ + G D+LVNNAGI ++ +++ E+ + +N + Y A VP Sbjct: 64 MAALAEAH----GAPDILVNNAGITHLPKPMEEVTEEEFDRVLAVNAKSVYLSARVFVPA 119 Query: 132 LKESSHGHLLHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGESDIRVNALLPGIV 191 +K G +L+IAS AG Y A+K ++ K++A EL IRVNAL P Sbjct: 120 MKARGSGAILNIASTAGVSPRPKLNWYNASKGWMITATKAMAVELAPFGIRVNALNPVAG 179 Query: 192 EGPRMDGVIRARAEQVGVPEAEMRQEYLNKISLKRMVTAEDVAAMALFLCSPAARNVTGQ 251 E P + A +G EMR ++L I L R ED+ A FLCS A +TG Sbjct: 180 ETPLL-------ASFMGEDTPEMRAKFLATIPLGRFSQPEDLGNAAAFLCSDEASMITGV 232 Query: 252 AISVDG 257 A+ VDG Sbjct: 233 AMEVDG 238 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 242 Length adjustment: 24 Effective length of query: 238 Effective length of database: 218 Effective search space: 51884 Effective search space used: 51884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory