Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate 3610772 Dshi_4158 acetoin reductase (RefSeq)
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >FitnessBrowser__Dino:3610772 Length = 257 Score = 112 bits (281), Expect = 6e-30 Identities = 75/249 (30%), Positives = 122/249 (48%), Gaps = 3/249 (1%) Query: 16 LISGAAAGIGAAIAQAFLDVGANVYICDVDPAAIDRARTA--HPQLHAGVADVSDCAQVD 73 L++G A GIG IA+ G + + D++ A ++ A + A ADV+ V Sbjct: 9 LVTGGAKGIGLGIAERLQRDGFALALVDMNGAQLEAAAAGLRDGPVIAITADVTQRDAVF 68 Query: 74 RIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFYFLRKAVPLLK 133 +D A ++LGG D++INNAGIA + ++ AE ++ N+ + ++ A K Sbjct: 69 AAVDRAEAELGGFDVMINNAGIA-QVQPIAEITEAELDQVHEVNVKGVVWGIQAAAAKFK 127 Query: 134 ETSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPNNVRVNAILPGVVE 193 II+ AS+A GYA Y ASK+A+ + + A E + + VNA PG+V Sbjct: 128 ARGHGGSIISAASIAAHDGYAMLGAYCASKFAVRALTQVAAKEFAADGITVNAYCPGIVG 187 Query: 194 GERMDRVISARAESLGIGFDQMKGEYLQKISLRRMVTVHDVAAMALFLASPAGQNISGQA 253 + + + AE G +++ I+L R T DVA + FLA P ++GQ Sbjct: 188 TDMWTEIDARFAELTGAAKGATYDAFVKSIALGRSETPEDVAGLVSFLAGPDSAYMTGQC 247 Query: 254 ISVDGNVEY 262 + +DG + Y Sbjct: 248 VIIDGGMVY 256 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 257 Length adjustment: 24 Effective length of query: 239 Effective length of database: 233 Effective search space: 55687 Effective search space used: 55687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory