Align alcohol dehydrogenase (cytochrome c) (EC 1.1.2.8) (characterized)
to candidate 3610679 Dshi_4060 Gluconate 2-dehydrogenase (acceptor) (RefSeq)
Query= BRENDA::D2SZY5 (472 letters) >FitnessBrowser__Dino:3610679 Length = 305 Score = 172 bits (435), Expect = 2e-47 Identities = 104/289 (35%), Positives = 151/289 (52%), Gaps = 15/289 (5%) Query: 8 AALGAVAVGLLAGTSLAHAQN--ADEDLIKKGEYVARLGDCVACHTSLN--GQKYAGGLS 63 A LGA ++G++ + A A E + +G Y+AR C+ACHT+ G AGG Sbjct: 12 AVLGAASLGVVIAWPVGSAVTPIAIEGNVDRGAYLARASGCIACHTNFEAGGAPLAGGAP 71 Query: 64 IKTPIGTIYSTNITPDPTYGIGTYTFKEFDEAVRHGVRKDGATLYPAMPYPSFARMTQDD 123 ++TP GT Y N+T DP +G+G +T ++F +AVR G+ DG YP+ PY +A + D Sbjct: 72 LETPFGTFYPPNLTTDPEHGMGEWTAEQFAKAVRQGIGPDGTPYYPSFPYTFYADFSDQD 131 Query: 124 MKALYAYFMHGVQPIAQKNHPTDISWPMSMRWPLSIWRSVFAPAPKDFTPAPGTDAEIAR 183 + L+A F V P+ + D+S+P RW L +WR+ F P D P G R Sbjct: 132 IADLWAAF-QTVPPVDEPAPENDVSFPFDQRWGLKLWRAAFFYDP-DTEPIEGRSDAWNR 189 Query: 184 GEYLVTGPGHCGACHTPRGF-GMQEKALDASGGPDFLGGGGVIDNWIAPSLRNDPVLGLG 242 G LV G HCGACHTPR G ++ +G GG AP++R ++ Sbjct: 190 GRELVRGAAHCGACHTPRNLAGGRDIGASFAGNAQLPGGSK------APAIRPKDLV-KN 242 Query: 243 RWSDEDLFLFLKSGRTDHSAAFGG-MADVVGWSTQYYTDADLHAMVKYI 290 W+ +L L++G T AFGG MA+VV T++ T AD AM ++ Sbjct: 243 DWTVSNLAYALQTGITPSGDAFGGSMAEVVREGTRFLTPADREAMALFL 291 Lambda K H 0.318 0.135 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 520 Number of extensions: 35 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 472 Length of database: 305 Length adjustment: 30 Effective length of query: 442 Effective length of database: 275 Effective search space: 121550 Effective search space used: 121550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory