Align Fructose import permease protein FruF (characterized)
to candidate 3606962 Dshi_0389 Monosaccharide-transporting ATPase (RefSeq)
Query= SwissProt::Q8G846 (356 letters) >FitnessBrowser__Dino:3606962 Length = 357 Score = 121 bits (304), Expect = 2e-32 Identities = 85/272 (31%), Positives = 141/272 (51%), Gaps = 6/272 (2%) Query: 58 LITMLQESARYLMIATGMTLVISTAGIDLSVGSVMAVAGAAAMQ-TLSNGMNVWLSILIA 116 L +LQ+ ++A +LVI TAGIDLSVG++M ++ Q T G+ V +++ Sbjct: 73 LTLILQQVQIVGIVAAAQSLVILTAGIDLSVGAIMVMSSVVMGQFTFRYGLPVEVAVACG 132 Query: 117 LAVGLAIGCVNGALVSFLGLQPFITTLIMMLAGRGMAKVITSGENTDASAVAGNEPL-KW 175 L G +G +NG LV+ + L PFI TL M + + E + + PL ++ Sbjct: 133 LLCGTLLGFINGWLVAKVKLPPFIVTLGMWQIVLAANFLYSRNETIRSQDIRDQAPLLQF 192 Query: 176 FANGFILG---IPANFVIAVIIVILVGLLCRKTAMGMMIEAVGINQEASRMTGIKPKKIL 232 F +G + + V++VI++ R TA G + AVG + EA+ ++G++ + L Sbjct: 193 FGTTLEIGGARLTYGVIFMVLLVIVLAYALRHTAWGRHVYAVGDDPEAAELSGVQVSRTL 252 Query: 233 FLVYAISGFLAAIAGLFATASVMRVDVVKTGQDLEMYAILAVVIGGTSLLGGKFSLAGSA 292 VY +SG + A AG + V +GQ + +I AVVIGG SL GG+ S+ G+ Sbjct: 253 ISVYMLSGLICAFAGWALIGRIGSVSPT-SGQLANIESITAVVIGGISLFGGRGSILGAF 311 Query: 293 VGAVIIAMIRKTIITLGVNAEATPAFFAVVVI 324 GA+I+ + + LG +A+ T +++I Sbjct: 312 FGALIVGVFTLGLRLLGADAQWTFLLIGLLII 343 Lambda K H 0.325 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 357 Length adjustment: 29 Effective length of query: 327 Effective length of database: 328 Effective search space: 107256 Effective search space used: 107256 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory