Align Monosaccharide-transporting ATPase; EC 3.6.3.17; Flags: Precursor (characterized, see rationale)
to candidate 3608017 Dshi_1424 inner-membrane translocator (RefSeq)
Query= uniprot:B2T9V8 (351 letters) >FitnessBrowser__Dino:3608017 Length = 343 Score = 130 bits (326), Expect = 7e-35 Identities = 102/337 (30%), Positives = 159/337 (47%), Gaps = 24/337 (7%) Query: 10 FGAAQAGAQSQLALPASRGKRARSELARLRELALLPALALLIVIGAFISPSFLTKANLIS 69 F A GA + + R KR R+E L +LL L L + + F + N+ S Sbjct: 5 FPTADTGAHAM----SRRPKRLRAEHRGLVLGSLL--LVALFTAASILVEGFASANNIRS 58 Query: 70 VLGASAALALVVLAESLIVLTGKFDLSLESTVGIAPAVGAMLVMPAASAGFGMQWPAAAG 129 +L +A L L L ++++ G DLS+ +G + + A L FG PA Sbjct: 59 ILLLAAFLGLAALGQTMVATVGGLDLSIPFVIGASNILLAYL--------FGTSLPAPLA 110 Query: 130 LLAIVVVGAVIGFINGFLVVRLRLNAFIVTLAMLIVLRG-----MLVGATKGGTLFDMPT 184 +L I+ +GA+IG +NG + R++ A I+TL + + G +G+ GT+F Sbjct: 111 ILCILAMGALIGVLNGVMSYRIQGQALILTLGVGFAVVGGAQIFTSLGSQFSGTVFSQVP 170 Query: 185 SFFA-----LATTIVLGLPLSVWLAAAAFAIAAFMLRYHRLGRALYAIGGNPEAARAAGI 239 +F+ TT L LP + + AA A F + R GRA+YAIGGN AA I Sbjct: 171 GWFSNIASISGTTFGLKLPPVILIWAAIAASLIFWINRTRAGRAIYAIGGNRTAAARLRI 230 Query: 240 RVERITWGVFVLGSILASVGGLIVTGYVGAINANQGNGMIFTVFAAAVIGGISLDGGKGT 299 R+ + + + A+ G ++ G+ G G+ +FT AA V+GG SL GG G Sbjct: 231 SEFRVWVSTYTISGLTAAATGCLLLGFSGGGFVGVGDPYLFTTVAAVVVGGTSLLGGTGG 290 Query: 300 MFGALTGVLLLGVVQNLLTLAQVPSFWIQAIYGAIIL 336 + GVL+L V+ + L + Q ++G +IL Sbjct: 291 YGATVIGVLVLQVLTSFLVGMGLDYAAQQTVFGLLIL 327 Lambda K H 0.326 0.140 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 351 Length of database: 343 Length adjustment: 29 Effective length of query: 322 Effective length of database: 314 Effective search space: 101108 Effective search space used: 101108 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory