Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate 3606962 Dshi_0389 Monosaccharide-transporting ATPase (RefSeq)
Query= uniprot:D8J112 (347 letters) >FitnessBrowser__Dino:3606962 Length = 357 Score = 186 bits (473), Expect = 6e-52 Identities = 111/303 (36%), Positives = 167/303 (55%), Gaps = 10/303 (3%) Query: 38 LAFASLLLMILFFS-FASPNFMEVDNLVSILQSTAVNGVLAIACTYVIITSGIDLSVGTM 96 +A LLL FFS FA L ILQ + G++A A + VI+T+GIDLSVG + Sbjct: 56 IAVFGLLLGSKFFSPFA---------LTLILQQVQIVGIVAAAQSLVILTAGIDLSVGAI 106 Query: 97 MTFCAVMAGVVLTNWGMPLPLGIAAAIFFGALSGWISGMVIAKLKVPPFIATLGMMMLLK 156 M +V+ G +G+P+ + +A + G L G+I+G ++AK+K+PPFI TLGM ++ Sbjct: 107 MVMSSVVMGQFTFRYGLPVEVAVACGLLCGTLLGFINGWLVAKVKLPPFIVTLGMWQIVL 166 Query: 157 GLSLVISGTRPIYFNDTEGFSAIAQDSLIGDLIPSLPIPNAVLILFLVAIGASIILNKTV 216 + + S I D + + Q I + V+ + L+ I + L T Sbjct: 167 AANFLYSRNETIRSQDIRDQAPLLQFFGTTLEIGGARLTYGVIFMVLLVIVLAYALRHTA 226 Query: 217 FGRYTFALGSNEEALRLSGVKVDFWKVAVYTFSGAICGIAGLIIASRLNSAQPALGQGYE 276 +GR+ +A+G + EA LSGV+V ++VY SG IC AG + R+ S P GQ Sbjct: 227 WGRHVYAVGDDPEAAELSGVQVSRTLISVYMLSGLICAFAGWALIGRIGSVSPTSGQLAN 286 Query: 277 LDAIAAVVIGGTSLSGGTGTILGTIIGAFIMSVLVNGLRIMSVAQEWQTVVTGVIIILAV 336 +++I AVVIGG SL GG G+ILG GA I+ V GLR++ +W ++ G++II AV Sbjct: 287 IESITAVVIGGISLFGGRGSILGAFFGALIVGVFTLGLRLLGADAQWTFLLIGLLIIAAV 346 Query: 337 YLD 339 +D Sbjct: 347 AVD 349 Lambda K H 0.326 0.139 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 273 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 357 Length adjustment: 29 Effective length of query: 318 Effective length of database: 328 Effective search space: 104304 Effective search space used: 104304 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory