Align ABC transporter for L-Fucose, permease component 1 (characterized)
to candidate 3607126 Dshi_0548 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= reanno::Smeli:SM_b21104 (298 letters) >FitnessBrowser__Dino:3607126 Length = 288 Score = 153 bits (387), Expect = 4e-42 Identities = 94/273 (34%), Positives = 149/273 (54%), Gaps = 8/273 (2%) Query: 15 PAFIVLAVFIVLPLIFSLYSSFTPFRLTKPDSLWVFIGFRNYVNVLTNAEFWVAFGRTVL 74 PA I LA+ + PL+++L++S + LTK + FIG NY VLT+ FW A GRT Sbjct: 16 PAVIGLALVGIAPLLYALWTSLHFYNLTKLRRV-EFIGLENYWTVLTDEVFWQAMGRTFF 74 Query: 75 LLTVALNAEMFLGLGLALLVNKA--TYGQRALRTAMMFPMMFSPVLVGFQFKFLFNDNIG 132 LL AL ++ LGLG+AL++++ T + R +++ PM + +VG + +FN G Sbjct: 75 LLGTALPLQIALGLGIALVLHQPGLTLVKTLARLSLVLPMATTYAVVGLLGQVMFNQKFG 134 Query: 133 FVNNALQSLGLTDRAIPWLIDGNLALFSIIVAEVWSSTAVFAILILAGLLAMPKDPVEAA 192 VN Q LG D I W+ D A II +VW T A+++LAGL +P + EAA Sbjct: 135 VVN---QLLGGAD--INWIGDPENAFAMIIFWDVWQWTPFVALVLLAGLTMVPGEVEEAA 189 Query: 193 HVDGCTPWQTFRYVTWPYLMPFAFIAMTIRSLDVARAYDIVKIMTDGGPAKRTELLWTLI 252 ++ + W RYV P+L+P + +R+ D + +D+V +T GGP TE + +I Sbjct: 190 RLETKSKWTVLRYVQLPFLLPGLVAVLILRTADTLKLFDMVFTLTRGGPGSSTEFISLMI 249 Query: 253 GRTAYGDARMGMANAMAYVAILLSIFFTVYFFR 285 R + G+A+A A + ++++I + R Sbjct: 250 QRVGFRGFDQGLASAQAIILLIITIVLAQIYIR 282 Lambda K H 0.331 0.142 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 288 Length adjustment: 26 Effective length of query: 272 Effective length of database: 262 Effective search space: 71264 Effective search space used: 71264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory