Align ABC transporter for L-Fucose, permease component 1 (characterized)
to candidate 3609760 Dshi_3143 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= reanno::Smeli:SM_b21104 (298 letters) >FitnessBrowser__Dino:3609760 Length = 290 Score = 147 bits (372), Expect = 2e-40 Identities = 87/280 (31%), Positives = 144/280 (51%), Gaps = 5/280 (1%) Query: 12 LLLPAFIVLAVFIVLPLIFSLYSSFTPFRLTKPDSLWVFIGFRNYV-NVLTNAEFWVAFG 70 L+LPA +V+ + PLI + SFT RL +P SL +IG+ NY FW + Sbjct: 10 LVLPAVVVVFATAIWPLIEAARMSFTVGRLNRPGSLEQYIGWENYAWAFFEEPAFWNSVY 69 Query: 71 RTVLLLTVALNAEMFLGLGLALLVNKATYGQRALRTAMMFPMMFSPVLVGFQFKFLFNDN 130 T L V + L LGLALL+ + + +T ++ P SP L+G F+F+FN Sbjct: 70 VTALYTVVTVGLTTLLALGLALLLAPGGRLRVSAQTLLILPFAMSPALIGVSFRFMFNPE 129 Query: 131 IGFVNNALQSLGLTDRAIPWLIDGNLALFSIIVAEVWSSTAVFAILILAGLLAMPKDPVE 190 G + + + WL D LA +++A+VW ++++ GL ++P+D +E Sbjct: 130 FGLFDAFFGVMIPPLADVSWLADPTLAFAVVVMADVWGWIPFLTLVLIGGLASVPRDTIE 189 Query: 191 AAHVDGCTPWQTFRYVTWPYLMPFAFIAMTIRSLDVARAYDIVKIMTDGGPAKRTELLWT 250 AA VDG + W+ FR VT P L P + + ++S+ + +D V ++T+GGP T+ L Sbjct: 190 AAQVDGASSWRVFRDVTLPQLGPVLAVVIILKSIFSLKTFDQVFMLTNGGPGTATQTLSH 249 Query: 251 LIGRTAYGDARMGMANAMAYVAILLSIFFTV----YFFRK 286 I ++G + ++A++ ++ IF T + FRK Sbjct: 250 YIYFNGMKYGQIGYSASVAWLMVIPMIFLTYAYAKFVFRK 289 Lambda K H 0.331 0.142 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 268 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 290 Length adjustment: 26 Effective length of query: 272 Effective length of database: 264 Effective search space: 71808 Effective search space used: 71808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory