Align ABC transporter for L-Fucose, permease component 2 (characterized)
to candidate 3607127 Dshi_0549 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= reanno::Smeli:SM_b21105 (288 letters) >FitnessBrowser__Dino:3607127 Length = 272 Score = 174 bits (442), Expect = 1e-48 Identities = 91/271 (33%), Positives = 151/271 (55%), Gaps = 7/271 (2%) Query: 17 AHLAGLFLAMLVICLPGLWIVLSSLRPTVEIMAKPPVWIPETLSLDAYRAMFSGAGQGGV 76 + +A L L + V P W+V +SL+ + + PPVWI E + A+F Sbjct: 9 SQIALLVLIITVCVFPFYWMVTTSLKTQIVALEAPPVWIFEPTLSNYREALFEDG----- 63 Query: 77 PVWDYFRNSLIVSVTSTVIALAIGLSGGYAFARYRFKAKSAIFLGFMLTRAVPGIALSLP 136 V NSLI+++++T +AL +G+ +A AR+ F+ K ++ F+ R + I L+LP Sbjct: 64 -VLRTLINSLIIAISTTFLALVLGVPAAFALARFEFRGKKDLWFWFITNRMISPIVLALP 122 Query: 137 LFMLYARTGIIDTHFSLILTYVALNVPFTIWLIDGFFRQVPKDLAEAAQIDGCTPWQAFW 196 F++ G++D H +LIL Y+ N+P IW++ FR +P DL EAA+++G + + Sbjct: 123 FFLIARNLGLLDKHITLILIYLTFNLPIVIWIVTDQFRGIPYDLDEAARLEGASQFTIMR 182 Query: 197 QVEFPLAGPGIASAGIFAFLTSWNEYALASQITRSVNSKTLPVGLLDYTAEFTIDWRGMC 256 ++ PLA PG+A + IF+F+ SWNE +TRS +KT P + + + + + + Sbjct: 183 KICLPLAMPGVAVSAIFSFIFSWNELMFGLILTRS-EAKTAPAMAVSFMEGYNLPYGKIM 241 Query: 257 ALAVVMIVPALTLTFIIQKHLVSGLTFGAVK 287 A + ++++P L I K LV GLT GAVK Sbjct: 242 ATSTLIVIPVLIFALIASKQLVRGLTMGAVK 272 Lambda K H 0.328 0.141 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 272 Length adjustment: 26 Effective length of query: 262 Effective length of database: 246 Effective search space: 64452 Effective search space used: 64452 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory