Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate 3608008 Dshi_1416 ABC transporter related (RefSeq)
Query= reanno::Smeli:SM_b21106 (365 letters) >FitnessBrowser__Dino:3608008 Length = 347 Score = 299 bits (766), Expect = 7e-86 Identities = 171/362 (47%), Positives = 222/362 (61%), Gaps = 20/362 (5%) Query: 1 MAPVTLKKLVKRYGALEVVHGIDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSGGAI 60 MA + L + KR+G+ V L + DREF+ L+GPSGCGK+TT+RMIAGLEE S G I Sbjct: 1 MAEIRLNHVQKRWGSFVGVEDFHLTIPDREFLVLLGPSGCGKTTTMRMIAGLEEPSSGEI 60 Query: 61 EIGGRKVNDLPPRARNISMVFQSYALYPHMTVAENMGFSLKIAGRPAEEIKTRVAEAAAI 120 IG R VN L P+ R+++MVFQSY LYP+M V EN+ F LK+ P E + RV A+A+ Sbjct: 61 WIGDRMVNALDPKDRDVAMVFQSYGLYPNMNVYENIRFPLKVRKVPEVEHEARVMRASAM 120 Query: 121 LDLAHLLERRPSQLSGGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRTEIKKLH 180 ++L L R+P+ LSGGQRQRVA+ RAIVR+P+VFL DEPLSNLDAKLR R +IK L Sbjct: 121 VELDDFLHRKPAALSGGQRQRVALARAIVREPNVFLMDEPLSNLDAKLRVSTRAQIKNLS 180 Query: 181 ARMQATMIYVTHDQVEAMTLSDRIVIMRDGHIEQVGTPEDVFRRPATKFVAGFIGSPPMN 240 +Q T IYVTHDQ+EAMTL+DR+V+M G ++QVGTP +++ RPA FVA FIGSP MN Sbjct: 181 HELQVTTIYVTHDQIEAMTLADRVVVMSAGVVQQVGTPMEIYDRPANTFVASFIGSPAMN 240 Query: 241 MEEAVLTDGKLAFASGATLPLPPRFRSLVREGQKVTFGLRPDDVYPSGHGLHAGDADAVH 300 + E +TDG A L +VT G R +D A D+ Sbjct: 241 LMEGAVTDGTFHGDRVA-------IAGLSGAAGRVTLGFRAED---------AQVVDSDG 284 Query: 301 EIELPVTITEPLGNETLVFTQFNGRDWVSRMLNPRPLRP--GEAVPMSFDLARAHLFDGE 358 +I PV E LG+ T+V + G + + P+ R G V + HLFD + Sbjct: 285 QIAAPVYSMELLGDATMVTVKAGGT--LVAVKAPKEFRAEIGAPVQIRIPTGICHLFDAQ 342 Query: 359 TG 360 TG Sbjct: 343 TG 344 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 353 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 347 Length adjustment: 29 Effective length of query: 336 Effective length of database: 318 Effective search space: 106848 Effective search space used: 106848 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory