Align SDR family oxidoreductase (characterized, see rationale)
to candidate 3607131 Dshi_0553 short-chain dehydrogenase/reductase SDR (RefSeq)
Query= uniprot:A0A4P7ABK7 (254 letters) >FitnessBrowser__Dino:3607131 Length = 255 Score = 136 bits (343), Expect = 4e-37 Identities = 92/258 (35%), Positives = 137/258 (53%), Gaps = 23/258 (8%) Query: 8 LAGKTVLITAAAQGIGRASTELFAREGARVIA--------TDIS---KTHLEELASIAGV 56 L KT L+T A+ GIGRA E+FA GA ++ TD+ KT + A+I G Sbjct: 9 LQDKTALVTGASSGIGRAIAEVFADAGADIVGQGRDLDRLTDLGAQIKTTGRQFAAITG- 67 Query: 57 ETHLLDVTDDDAIKALVAKVGTVDVLFNCAGYVAAGNILECDDKAWDFSFNLNAKAMFHT 116 + D T + A +AL A G +D+L N AG G + D W + +N A F Sbjct: 68 DLADPDQTQNVADRALAA-FGKIDILVNSAGIAVTGPVTNYDLDDWQRTLAVNLTAPFIL 126 Query: 117 IRAVLPGMLAKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADFVSQGIRC 176 +AV+PGM+ +K G I+NI+S + V + + AY SK + LTKS+ + ++ Sbjct: 127 SKAVMPGMMQRKQGKIINISSQ-TGVIALKDHAAYATSKGGLNALTKSLMTEAAPHNVQV 185 Query: 177 NAICPGTIESPSLNQRISTQAKETGKSEDEVRAAFVARQPMGRIGKAEEVAALALYLASD 236 NAICP + ++ KE S E + F+AR P+GR G+ E+A +ALYLAS Sbjct: 186 NAICPTVV--------LTEMGKELW-SAPERKDPFIARTPLGRFGEPIEIADMALYLASP 236 Query: 237 ESNFTTGSIHMIDGGWSN 254 S+ G++ MI+GG+S+ Sbjct: 237 ASDLVNGAVMMIEGGYSS 254 Lambda K H 0.316 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 125 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 255 Length adjustment: 24 Effective length of query: 230 Effective length of database: 231 Effective search space: 53130 Effective search space used: 53130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory