Align 2-keto-3-deoxy-L-fuconate dehydrogenase; EC 1.1.1.- (characterized)
to candidate 3608847 Dshi_2239 short-chain dehydrogenase/reductase SDR (RefSeq)
Query= SwissProt::Q8P3K4 (300 letters) >FitnessBrowser__Dino:3608847 Length = 250 Score = 131 bits (330), Expect = 1e-35 Identities = 87/258 (33%), Positives = 135/258 (52%), Gaps = 16/258 (6%) Query: 49 IPTTPNTRLQGKRCLITAAGAGIGRESALACARAGAHVI-----ATDIDAAALQALAAES 103 +P TP+ RL G+R L+T A GIG A+A A AGAHV+ ++DAAA + + AE Sbjct: 2 LPRTPSFRLDGQRALVTGASRGIGLGCAVALAEAGAHVVMAARGQAELDAAATE-MRAEG 60 Query: 104 DAITTQLLDVTDAAAITALVAAHGPFDVLFNCAGYVHQGSILDCDEPAWRRSFSINVDAM 163 ++ T +LD+ D A A PFD L N AG LD + S+N+ A Sbjct: 61 WSVETAVLDIADLDAQAEFFGAQAPFDCLVNSAGLARHSPALDTRPEDFDAVMSVNLRAA 120 Query: 164 YYTCKAVLPGMLERGRGSIINMSSVASSIKGVPNRFVYGVTKAAVIGLSKAIAADYVAQG 223 Y+ M + GSI+ +SS + G+ +R VY +K V G++KA+A ++ +G Sbjct: 121 YFLATNAARTMPD--GGSIVQISSQMGHVGGL-DRAVYCASKHGVEGMTKAMAQEFGPRG 177 Query: 224 VRCNAICPGTIKTPSLGQRVQALGGD-EQAVWKSFTDRQPMGRLGDPREIAQLVVYLASD 282 +R N++CP I+TP +A D E+ W + + R+ + +I VV+L S Sbjct: 178 IRVNSLCPTFIRTP----LTEATFADPEKRAW--IMGKIKLPRVAEIEDIMGAVVFLCSP 231 Query: 283 ESSFTTGQTHIIDGGWSN 300 S+ TG ++DGGW++ Sbjct: 232 ASAMVTGTGLLVDGGWTS 249 Lambda K H 0.320 0.133 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 250 Length adjustment: 25 Effective length of query: 275 Effective length of database: 225 Effective search space: 61875 Effective search space used: 61875 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory