Align Short-chain dehydrogenase/reductase SDR (characterized, see rationale)
to candidate 3609507 Dshi_2891 short-chain dehydrogenase/reductase SDR (RefSeq)
Query= uniprot:B2T9V3 (247 letters) >FitnessBrowser__Dino:3609507 Length = 242 Score = 142 bits (358), Expect = 6e-39 Identities = 94/247 (38%), Positives = 133/247 (53%), Gaps = 15/247 (6%) Query: 4 RLAGKTALITAAGQGIGLATAELFAREGARVIATDIRIDGLAGKPVE-----ARKLDVRD 58 RL GKTA++T G G G FA EGA+VI DI G A E A ++DV D Sbjct: 2 RLEGKTAIVTGGGSGFGAGIVRKFAAEGAQVIVADIN-KGAAEAVAEEYGGTAAQVDVSD 60 Query: 59 DAAIKALAAEIGAVDVLFNCAGFVHAGNILE-CSEEDWDFAFDLNVKAMYRMIRAFLPAM 117 ++ ALA GA D+L N AG H +E +EE++D +N K++Y R F+PAM Sbjct: 61 ADSMAALAEAHGAPDILVNNAGITHLPKPMEEVTEEEFDRVLAVNAKSVYLSARVFVPAM 120 Query: 118 LDKGGGSIINMSSAASSVKGVPNRFAYSASKAAVIGLTKSVAADFITRGVRCNAICPGTV 177 +G G+I+N++S A V P Y+ASK +I TK++A + G+R NA+ P Sbjct: 121 KARGSGAILNIASTAG-VSPRPKLNWYNASKGWMITATKAMAVELAPFGIRVNALNPVAG 179 Query: 178 ASPSLEQRIVAQAQAQGATLDAVQAAFVARQPMGRIGKPEEIAALALYLGSDESSFTTGH 237 +P L A G ++A F+A P+GR +PE++ A +L SDE+S TG Sbjct: 180 ETPLL-------ASFMGEDTPEMRAKFLATIPLGRFSQPEDLGNAAAFLCSDEASMITGV 232 Query: 238 AHVIDGG 244 A +DGG Sbjct: 233 AMEVDGG 239 Lambda K H 0.320 0.133 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 8 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 242 Length adjustment: 24 Effective length of query: 223 Effective length of database: 218 Effective search space: 48614 Effective search space used: 48614 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory