GapMind for catabolism of small carbon sources

 

Alignments for a candidate for dctQ in Dinoroseobacter shibae DFL-12

Align dicarboxylate TRAP transporter (succinate, fumarate, L-malate, and alpha-ketoglutarate), small permease component (characterized)
to candidate 3608436 Dshi_1833 Tripartite ATP-independent periplasmic transporter DctQ component (RefSeq)

Query= reanno::PV4:5208944
         (212 letters)



>FitnessBrowser__Dino:3608436
          Length = 188

 Score = 64.3 bits (155), Expect = 1e-15
 Identities = 35/110 (31%), Positives = 58/110 (52%), Gaps = 3/110 (2%)

Query: 2   MSRFF---SHIEEVVLNALITAMTLLVFVEVIARFFFNTGFLWIQELTLTICGWFVLFGM 58
           M++F+    +IE  +   L+     L+F++VI R  F+  F W++EL++ +  WFV FG 
Sbjct: 1   MTKFWHIVDNIESYICRTLLAIFVCLLFLQVIVRTLFDFSFSWVEELSIYMFVWFVFFGA 60

Query: 59  SYGVKVGAHIGVDAFVKKLPAQGRKYTAILAVAICLIYCGMFLVGSWDYL 108
           SY  K+GAH  V    K LP +  KY    A    + +   F+  + D++
Sbjct: 61  SYAAKMGAHNRVTFQFKFLPPRKIKYIEAFADLFWIFFNVYFVYLAIDFI 110


Lambda     K      H
   0.329    0.144    0.453 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 117
Number of extensions: 4
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 212
Length of database: 188
Length adjustment: 21
Effective length of query: 191
Effective length of database: 167
Effective search space:    31897
Effective search space used:    31897
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 45 (21.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory