Align Arabinose ABC transporter permease (characterized, see rationale)
to candidate 3609042 Dshi_2431 Monosaccharide-transporting ATPase (RefSeq)
Query= uniprot:A0A161GM94 (322 letters) >FitnessBrowser__Dino:3609042 Length = 328 Score = 162 bits (410), Expect = 1e-44 Identities = 94/310 (30%), Positives = 165/310 (53%), Gaps = 3/310 (0%) Query: 12 RKPLDLRRFLDDWVMLLAAIGIFVLCTLMIDNFLSPLNMRGLGLAISTTGIAACTMLYCL 71 R P++ R + ++LL AIGIFV + FL+ N+ + + A M + Sbjct: 13 RSPMEQRLKSWETLLLLVAIGIFVANSFASPYFLNAWNLSDATFNFTEKAMIAFAMALLI 72 Query: 72 ASGHFDLSVGSVIACAGV-VAAVVMRDTNSVFLGISAALVMGLIVGLINGIVIAKLRVNA 130 SG DLSV S+IA A + A V + L + L +GL+ G NG+++ ++ + + Sbjct: 73 ISGEIDLSVASIIALASTAMGAAVQMGVGTPGL-VLIGLGVGLLCGAFNGVLVTRMGLPS 131 Query: 131 LITTLATMQIVRGLAYIFANGKAVGVSQESFFVFGNGQMFGV-PVPILITIVCFLFFGWL 189 ++ T+ TM + RG++YI +A ESF FG G ++ V +++ + + + L Sbjct: 132 IVVTIGTMSLFRGISYIVLGDQAFRGYPESFSWFGQGYVWWVISFELVLFAIIAVIYAML 191 Query: 190 LNYTTYGRNTMAIGGNQEAALLAGVNVDRTKIIIFAVHGVIGALAGVILASRMTSGQPMI 249 L+ T +GR AIG N A+ +G+ V R K I+F + G++ +A + L +R+ S +P I Sbjct: 192 LHKTNFGRAVYAIGNNATGAMFSGIRVQRVKFILFLLTGLMSGVAAICLTARLGSTRPSI 251 Query: 250 GQGFELTVISACVLGGVSLSGGIGMIRHVIAGVLILAIIENAMNLKNIDTFYQYVIRGSI 309 G+EL V++ VLGGVS+ GG G I V+ ++ ++ + L N+ ++ G++ Sbjct: 252 AMGWELEVVTMVVLGGVSILGGSGTILGVVIAAFVMGLVTFGLGLLNVPGIVMSIVIGAL 311 Query: 310 LLLAVVIDRL 319 L+ + + RL Sbjct: 312 LIGVIALPRL 321 Lambda K H 0.330 0.144 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 322 Length of database: 328 Length adjustment: 28 Effective length of query: 294 Effective length of database: 300 Effective search space: 88200 Effective search space used: 88200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory