Align 2-dehydro-3-deoxygalactonokinase (characterized, see rationale)
to candidate 3607834 Dshi_1242 2-dehydro-3-deoxygalactonokinase (RefSeq)
Query= uniprot:A0A1I2AR49 (306 letters) >FitnessBrowser__Dino:3607834 Length = 298 Score = 157 bits (396), Expect = 4e-43 Identities = 110/269 (40%), Positives = 138/269 (51%), Gaps = 11/269 (4%) Query: 6 IGLDWGSTHLRAYLYGADGHALESRALPHGIRQLPAGGFPEAFSSAVRDWPALP--VLAC 63 I +DWG++HLRA+ + A L A G+ L F A + + W P VLAC Sbjct: 7 IAVDWGTSHLRAW-HMAQDRVLAEAASDAGMSALGRADFEAALLALIAGWLDGPTDVLAC 65 Query: 64 GMVGSRNGWQEVPYLDTPTGVERLAQHLTRIAAPDGHA-LYLVPGLHDTHRPDVMRGEET 122 GMVGSR GWQE PY P L R A D +++VPGL DVMRGEET Sbjct: 66 GMVGSRQGWQEAPYSAVPCAP--LGAAPVRAHATDPRLRVHIVPGLKQVRPADVMRGEET 123 Query: 123 QIAGVLAREPATTRLL-LPGTHSKWVRLRDGIVTDFATVMTGELYGLLRQHSILGAALPE 181 Q+AG LAR P ++ LPGTH+KW + G V F T MTGELY L +HS+L +L E Sbjct: 124 QVAGFLARNPGWDGVVCLPGTHTKWAHVSAGEVVSFQTFMTGELYFTLARHSVLRHSLTE 183 Query: 182 ARDDADAFRRGVAAARGSGPAGALSLLFSARALMLDGVLDPAAVPDYLSGLLIGEELRMA 241 A DA+AF G+ + P + LF RA L P A LSGLLIG EL +A Sbjct: 184 AGWDAEAFADGLKDGM-ARPERLAARLFGLRAADLLENASPEATRARLSGLLIGAEL-VA 241 Query: 242 LAAGWADADDAIPMVGEGPLCDRYRRAAD 270 W + +VG + Y+ A D Sbjct: 242 ARPYW--LGQQVALVGAAKVTGPYKNALD 268 Lambda K H 0.321 0.138 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 313 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 306 Length of database: 298 Length adjustment: 27 Effective length of query: 279 Effective length of database: 271 Effective search space: 75609 Effective search space used: 75609 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory