Align Putative sugar lactone lactonase; EC 3.1.1.- (characterized, see rationale)
to candidate 3607832 Dshi_1240 SMP-30/Gluconolaconase/LRE domain protein (RefSeq)
Query= uniprot:Q92RN9 (294 letters) >FitnessBrowser__Dino:3607832 Length = 286 Score = 158 bits (400), Expect = 1e-43 Identities = 100/277 (36%), Positives = 138/277 (49%), Gaps = 12/277 (4%) Query: 19 LGEGPTFDPGTGTAWWFNITGRELHELHLESGRKAIHPLPF----LGSVLAVIDPLRQLI 74 LGEGP + P +WF+ITG+ + R PL + + S +D LI Sbjct: 13 LGEGPLWHPERQQLFWFDITGQRM------LSRDGDTPLEWQFDEMVSAAGWVDHDTLLI 66 Query: 75 ASDQGLFVRDTESSKLGHFATLE-EKPGNRSNDGRIHPCGALWIGTMGRSAEKHAGAIYH 133 AS+ L D + A LE ++P RSNDGR P G WIGTMG+SAE AGAIY Sbjct: 67 ASETALVTFDLAEGESRFVAPLEADRPETRSNDGRADPWGGFWIGTMGKSAEPGAGAIYR 126 Query: 134 VAGSRVTKLYSNITIPNAICFSPDGATAYFTDTDVNQLMRVDIDPATALPTGDPVLLSDE 193 + + ++ ++TI NA+CF + AY+ DT Q+MR+ +D P+G + D Sbjct: 127 LFDGTLRRVVRDVTISNALCFDAAQSCAYYADTPTRQVMRLPLD-GDGWPSGPATVAVDL 185 Query: 194 STSPGGVDGAVCDADGLIWNARWGASAVEVYKPDGQKVARYAVPATQPSCPAFVGAKAER 253 DGAV DA G +W A+WGA V + PDG + A SCPAF G ++ Sbjct: 186 RAEGLNPDGAVTDAAGNLWIAQWGAGRVACHAPDGTFLRALACGGRHSSCPAFGGPDLDQ 245 Query: 254 LLVTSAWQGMDDAARAADPHAGKTFELGIEVKGRFEP 290 L +T+A +G+ AA P G F +G EP Sbjct: 246 LFITTAREGLSADDIAAAPENGCVFAAEGVARGLPEP 282 Lambda K H 0.317 0.135 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 286 Length adjustment: 26 Effective length of query: 268 Effective length of database: 260 Effective search space: 69680 Effective search space used: 69680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory