Align Inner membrane ABC transporter permease protein YjfF (characterized)
to candidate 3609043 Dshi_2432 Monosaccharide-transporting ATPase (RefSeq)
Query= SwissProt::P37772 (331 letters) >FitnessBrowser__Dino:3609043 Length = 327 Score = 130 bits (327), Expect = 4e-35 Identities = 101/334 (30%), Positives = 164/334 (49%), Gaps = 20/334 (5%) Query: 1 MIKRNLPLMITIGVFVLGYLYCL--TQFPGFASTRVICNILTDNAFLGIIAVGMTFVILS 58 M+KR + T+ + + L L ++FP F + + ++ D + L ++A+G VIL+ Sbjct: 1 MLKRLIASRETLLIAAILLLLALIASRFPAFIAPSNLAHVFNDTSPLILLAIGQMIVILT 60 Query: 59 GGIDLSVGSVIAFTGVFLAKV-IGDFGLSPLLAFPLVLVMGCAFGAFMGLLIDALKIPAF 117 IDLSV + +A TG+ ++ V + GL ++ + + +G G F GLL+ L+IP Sbjct: 61 RCIDLSVAANLALTGMVVSMVNVAAPGLPIVVILAIAIGLGTLLGMFNGLLVWKLQIPPI 120 Query: 118 IITLAGMFFLRGVSYLVSEESIPINHPIYDTLSSLAWKIPGGGRLSAMGLL----MLAVV 173 ++TL M RG+ +L+S+ +H + S A+K L + +L +LAV+ Sbjct: 121 VVTLGTMTIFRGIIFLISDGKWVNSHEM-----SPAFKAFPRAELLGLPVLSWIAILAVI 175 Query: 174 VIGIFLAHRTRFGNQVYAIGGNATSANLMGISTRSTTIRIYMLSTGLATLAGIVFSIYTQ 233 + I + RT G YA GGN +A GI T + +S LA L G ++ Sbjct: 176 LFTIVMT-RTTLGRAFYAAGGNPHAATYAGIDVGKTQFWAFTISGALAGLTGYLWVSRFA 234 Query: 234 AGYALAGVGVELDAIASVVIGGTLLSGGVGTVLGTLFGVAIQGLIQTYINFDGTLSSWWT 293 Y G ELD +A+ VIGG + GGVGTV G L G G+I+ + +S +W Sbjct: 235 VSYVDIAGGFELDVVAACVIGGVSIMGGVGTVGGALLGALFLGIIKNALPV-VDISPFWQ 293 Query: 294 KIAIGILLFIFIAL------QRGLTVLWENRQSS 321 G + I +AL ++G +L Q+S Sbjct: 294 LAISGGAIIIAVALNAQANRKKGRIILKRAEQTS 327 Lambda K H 0.329 0.145 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 327 Length adjustment: 28 Effective length of query: 303 Effective length of database: 299 Effective search space: 90597 Effective search space used: 90597 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory